WDR8 Polyclonal antibody

• 

  IHC staining of human heart using 27628-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 27628-1-AP (WDR8 antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human heart using 27628-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 27628-1-AP (WDR8 antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human brain using 27628-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 27628-1-AP (WDR8 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human brain using 27628-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 27628-1-AP (WDR8 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

WDR8 Polyclonal Antibody for IHC, ELISA

Cat No. 27628-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

IHC, ELISA

Synonyms

WD repeat containing protein 8, WD repeat domain 8, WD repeat-containing protein WRAP73, WDR8, WRAP73

---

Tested Applications

• Positive IHC detected in: human heart tissue, human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27628-1-AP targets WDR8 in IHC, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26267

  Product name: Recombinant human WDR8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 201-413 aa of BC002611

  Sequence: EYKILLYSLDGRLLSTYSAYEWSLGIKSVAWSPSSQFLAVGSYDGKVRILNHVTWKMITEFGHPAAINDPKIVVYKEAEKSPQLGLGCLSFPPPRAGAGPLPSSESKYEIASVPVSLQTLKPVTDRANPKIGIGMLAFSPDSYFLATRNDNIPNAVWVWDIQKLRLFAVLEQLSPVRAFQWDPQQPRLAICTGGSRLYLWSPAGCMSVQVPGE

• Full Name: WD repeat domain 8
• Calculated Molecular Weight: 460 aa, 52 kDa
• GenBank Accession Number: BC002611
• Gene Symbol: WDR8
• Gene ID (NCBI): 49856
• RRID: AB_2880929
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P2S5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.