WDR91 Polyclonal antibody

• 

  WB analysis using 27424-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27424-1-AP (WDR91 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

WDR91 Polyclonal Antibody for WB, ELISA

Cat No. 27424-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

HSPC049, WD repeat domain 91, WDR91

---

Tested Applications

• Positive WB detected in: HEK-293 cells, Jurkat cells, SH-SY5Y cells, U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27424-1-AP targets WDR91 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26697

  Product name: Recombinant human WDR91 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 178-365 aa of BC017246

  Sequence: FDAECQRTNQVQEENEVLRQKLFALQAEIHRLKKEEQQPEEEEALVQHKLPPYVSNMDRLGDSELAMVCSQRNASLSQSPRVGFLSSLLPQSKKSPSRLSPAQGPPQPQSSAKKESFGGQGTKGKDPTSGAKDGKSLLSGLATGESGWSQHRQRRLQDHGKERKELFSTTTSQCAEKKPEASGPEAEP

• Full Name: WD repeat domain 91
• Observed Molecular Weight: 42 kDa, 83 kDa
• GenBank Accession Number: BC017246
• Gene Symbol: WDR91
• Gene ID (NCBI): 29062
• RRID: AB_3669601
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: A4D1P6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

WDR91 (1-405 aa) can be detected 42 kDa (PMID:28860274).