Product Information
29474-1-PBS targets WEE1 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30194 Product name: Recombinant human WEE1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 515-646 aa of BC051831 Sequence: PLPRNGDQWHEIRQGRLPRIPQVLSQEFTELLKVMIHPDPERRPSAMALVKHSVLLSASRKSAEQLRIELNAEKFKNSLLQKELKKAQMAKAAAEERALFTDRMATRSTTQSNRTSRLIGKKMNRSVSLTIY Predict reactive species |
| Full Name | WEE1 homolog (S. pombe) |
| Calculated Molecular Weight | 72 kDa |
| Observed Molecular Weight | 72 kDa,110 kDa |
| GenBank Accession Number | BC051831 |
| Gene Symbol | WEE1 |
| Gene ID (NCBI) | 7465 |
| RRID | AB_2918314 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P30291 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
WEE1 kinase is a serine-threonine kinase that regulates G2/M checkpoint transition. WEE1 triggers G2/M arrest through inhibitory phosphorylation on Tyr15 of CDK1 (Cdc2) and preventing entry into mitosis to allow DNA repair during DNA damage (PMID: 27427153).The predicted native molecular weight for Wee1 based on the intact human Wee1 cDNA sequence is 72 kDa, whereas the 95-110 kDa protein is a highly modified product (PMID: 7568188). Others have shown that Wee1 is 70-72 kDa and 49-55 kDa (PMID: 12214061).

