HE4 Polyclonal antibody

• 

  IHC staining of human ovary tumor using 14406-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 14406-1-AP (HE4 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary tumor using 14406-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 14406-1-AP (HE4 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human testis using 14406-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 14406-1-AP (HE4 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human testis using 14406-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 14406-1-AP (HE4 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human testis using 14406-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 14406-1-AP (HE4 antibody) at dilution of 1:25 (under 10x lens).

• 

  IHC staining of human testis using 14406-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 14406-1-AP (HE4 antibody) at dilution of 1:25 (under 40x lens).

• 

  IF Staining of MCF-7 using 14406-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed MCF-7 cells using 14406-1-AP (HE4 antibody) at dilution of 1:200 and CoraLite488-Conjugated Goat Anti-Rabbit IgG(H+L).

HE4 Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 14406-1-AP

Publications(8)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

WFDC2, WAP5, WAP four-disulfide core domain protein 2, WAP four disulfide core domain protein 2, Major epididymis-specific protein E4

---

Tested Applications

• Positive IHC detected in: human ovary tumor tissue, human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• IHC: See 2 publications below

Product Information

14406-1-AP targets HE4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5684

  Product name: Recombinant human HE4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 21-124 aa of BC046106

  Sequence: GFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF

• Full Name: WAP four-disulfide core domain 2
• Calculated Molecular Weight: 13 kDa
• GenBank Accession Number: BC046106
• Gene Symbol: HE4
• Gene ID (NCBI): 10406
• RRID: AB_2878055
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14508
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

WFDC2, also named as HE4, is a member of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. HE4 is expressed in a number of normal tissues, and it is also highly expressed in a number of tumors cells lines, such ovarian, colon, breast, lung and renal cells lines. In some study, HE4 was referred to as a biomarker for ovarian carcinoma.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Biosens Bioelectron; An ultrasensitive ratiometric electrochemiluminescence immunosensor combining photothermal amplification for ovarian cancer marker detection.; Authors - Dandan Fang
mouse	WB	Oncotarget; Bcl-3 is a novel biomarker of renal fibrosis in chronic kidney disease.; Authors - Ran Chen
mouse	WB	Food Funct; EPA and DHA differentially coordinate the crosstalk between host and gut microbiota and block DSS-induced colitis in mice by a reinforced colonic mucus barrier.; Authors - Jian Fang
human		RSC Adv; Machine learning algorithms enhance the specificity of cancer biomarker detection using SERS-based immunoassays in microfluidic chips; Authors - Nariman Banaei
human	IHC	Iran J Pathol; HE4, A New Potential Tumor Marker for Early Diagnosis and Predicting of Breast Cancer Progression.; Authors - Nazanin Mirmohseni Namini
human	IHC	Cell Rep; YAP targetome reveals activation of SPEM in gastric pre-neoplastic progression and regeneration; Authors - Adrian K H Loe