Tested Applications
Positive IHC detected in | human ovary tumor tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
IHC | See 2 publications below |
Product Information
14406-1-AP targets HE4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag5684 Product name: Recombinant human HE4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 21-124 aa of BC046106 Sequence: GFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF Predict reactive species |
Full Name | WAP four-disulfide core domain 2 |
Calculated Molecular Weight | 13 kDa |
GenBank Accession Number | BC046106 |
Gene Symbol | HE4 |
Gene ID (NCBI) | 10406 |
RRID | AB_2878055 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q14508 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
WFDC2, also named as HE4, is a member of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. HE4 is expressed in a number of normal tissues, and it is also highly expressed in a number of tumors cells lines, such ovarian, colon, breast, lung and renal cells lines. In some study, HE4 was referred to as a biomarker for ovarian carcinoma.
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for HE4 antibody 14406-1-AP | Download protocol |
IF protocol for HE4 antibody 14406-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Biosens Bioelectron An ultrasensitive ratiometric electrochemiluminescence immunosensor combining photothermal amplification for ovarian cancer marker detection. | ||
Food Funct EPA and DHA differentially coordinate the crosstalk between host and gut microbiota and block DSS-induced colitis in mice by a reinforced colonic mucus barrier. | ||
RSC Adv Machine learning algorithms enhance the specificity of cancer biomarker detection using SERS-based immunoassays in microfluidic chips | ||
Iran J Pathol HE4, A New Potential Tumor Marker for Early Diagnosis and Predicting of Breast Cancer Progression. | ||
Cell Rep YAP targetome reveals activation of SPEM in gastric pre-neoplastic progression and regeneration |