WISP3 Polyclonal antibody, PBS Only

• 

  WB analysis of Caco-2 using 21259-1-AP (same clone as 21259-1-PBS)

  Caco-2 cells were subjected to SDS PAGE followed by western blot with 21259-1-AP (WISP3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21259-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 21259-1-AP (same clone as 21259-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 21259-1-AP (WISP3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21259-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 21259-1-AP (same clone as 21259-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 21259-1-AP (WISP3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21259-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 21259-1-AP (same clone as 21259-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 21259-1-AP (WISP3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21259-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 21259-1-AP (same clone as 21259-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 21259-1-AP (WISP3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21259-1-PBS in a different storage buffer formulation.

WISP3 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 21259-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

21259-1-PBS targets WISP3 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15238

  Product name: Recombinant human WISP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-196 aa of BC012028

  Sequence: MQGLLFSTLLLAGLAQFCCRVQGTGPLDTTPEGRPGEVSDAPQRKQFCHWPCKCPHQKPRCPPGVSLVRDGCGCCKICAKQPGEICNEADLCDPHKGLYCDYSVDRPRYETGVCAYLVAVGCEFNQVHYHNGQVFQPNPLFSCLCVSGAIGCTPLFIPKLAGSHCSGAKGGKKSDQSNCSLEPLLQQLSTSYKTMP

• Full Name: WNT1 inducible signaling pathway protein 3
• Calculated Molecular Weight: 372 aa, 41 kDa
• Observed Molecular Weight: 39-41 kDa
• GenBank Accession Number: BC012028
• Gene Symbol: WISP3
• Gene ID (NCBI): 8838
• RRID: AB_2918070
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95389
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.