WISP3 Polyclonal antibody

• 

  WB analysis of Caco-2 using 21259-1-AP

  Caco-2 cells were subjected to SDS PAGE followed by western blot with 21259-1-AP (WISP3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 21259-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 21259-1-AP (WISP3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 21259-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 21259-1-AP (WISP3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 21259-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 21259-1-AP (WISP3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 21259-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 21259-1-AP (WISP3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

WISP3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 21259-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, CoIP, ELISA

Synonyms

CCN family member 6, CCN6, LIBC, PPAC, PPD, WISP 3, WISP3

---

Tested Applications

• Positive WB detected in: Caco-2 cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• IHC: See 1 publications below
• CoIP: See 1 publications below

Product Information

21259-1-AP targets WISP3 in WB, IHC, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15238

  Product name: Recombinant human WISP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-196 aa of BC012028

  Sequence: MQGLLFSTLLLAGLAQFCCRVQGTGPLDTTPEGRPGEVSDAPQRKQFCHWPCKCPHQKPRCPPGVSLVRDGCGCCKICAKQPGEICNEADLCDPHKGLYCDYSVDRPRYETGVCAYLVAVGCEFNQVHYHNGQVFQPNPLFSCLCVSGAIGCTPLFIPKLAGSHCSGAKGGKKSDQSNCSLEPLLQQLSTSYKTMP

• Full Name: WNT1 inducible signaling pathway protein 3
• Calculated Molecular Weight: 372 aa, 41 kDa
• Observed Molecular Weight: 39-41 kDa
• GenBank Accession Number: BC012028
• Gene Symbol: WISP3
• Gene ID (NCBI): 8838
• RRID: AB_2918070
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95389
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB,IHC,CoIP	Biochem Pharmacol; WISP3 upregulates SDCBP expression to promote the progression of non-small cell lung cancer via the TGF-β signaling pathway; Authors - Xiaoshen Zhang
human	WB	Exp Hematol Oncol; Fibronectin promotes tumor angiogenesis and progression of non-small-cell lung cancer by elevating WISP3 expression via FAK/MAPK/ HIF-1α axis and activating wnt signaling pathway; Authors - Fei Zhou
human	WB	Front Mol Biosci; Construction of shared gene signature between rheumatoid arthritis and lung adenocarcinoma helps to predict the prognosis and tumor microenvironment of the LUAD patients; Authors - Liping Shi