WISP3 Polyclonal antibody

WISP3 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 26406-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

WNT1-inducible-signaling pathway protein 3, WISP-3, Cellular communication network factor 6, CCN6

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inCaco-2 cells, COLO 320 cells, HeLa cells, HepG2 cells
Positive IHC detected inhuman colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26406-1-AP targets WISP3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag23999

Product name: Recombinant human WISP3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 231-295 aa of BC105941

Sequence: ATKWTPCSRTCGMGISNRVTNENSNCEMRKEKRLCYIQPCDSNILKTIKIPKGKTCQPTFQLSKA

Predict reactive species
Full Name WNT1 inducible signaling pathway protein 3
Observed Molecular Weight39-42 kDa
GenBank Accession NumberBC105941
Gene Symbol WISP3
Gene ID (NCBI) 8838
RRIDAB_3085867
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO95389
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

WISP3, also known as CCN6. Localized to the Mitochondria, and It is reported that CCN6 is located in the nucleus of breast cancer (PMID: 21262769). It is mainly expressed in adult kidney, testis and fetal kidney, and weakly expressed in placenta, ovary, prostate and small intestine (PMID: 9843955, PMID: 10471507). This gene is overexpressed in colon tumors, and it may be located downstream of WNT1 signaling pathway related to malignant transformation. Mutations of this gene are associated with progressive pseudorheumatoid dysplasia, an autosomal recessive skeletal disorder, indicating that the gene is essential for normal postnatal skeletal growth and cartilage homeostasis. Also it plays an important role in mitochondrial electron transfer and mitochondrial respiration, and may be important in bone growth and cartilage homeostasis after normal birth through its regulation of mitochondrial function (PMID: 27252383, PMID: 10471507). The calculated molecular weight of WISP3 is 39 kDa, and this antibody can recognize the 41 kDa isoform of WISP3.

Protocols

Product Specific Protocols
IF protocol for WISP3 antibody 26406-1-APDownload protocol
IHC protocol for WISP3 antibody 26406-1-APDownload protocol
WB protocol for WISP3 antibody 26406-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...