Published Applications
| WB | See 3 publications below |
Product Information
21414-1-AP targets WNT3A in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15834 Product name: Recombinant human WNT3A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 19-120 aa of BC103921 Sequence: SYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQLRFCRNYVEIMPSVAEGIKIGIQECQHQFRGRRWNCTTVHDSLAIFGPVLDKATRESAFVHAIASAGV Predict reactive species |
| Full Name | wingless-type MMTV integration site family, member 3A |
| Calculated Molecular Weight | 352 aa, 39 kDa |
| GenBank Accession Number | BC103921 |
| Gene Symbol | WNT3A |
| Gene ID (NCBI) | 89780 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P56704 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Publications
| Species | Application | Title |
|---|---|---|
J Dent Sci Wnt/Ca2+ pathway inhibits neural differentiation of human dental pulp stem cells in vitro | ||
Stem Cells Int Shh Signaling from the Injured Lung Microenvironment Drives BMSCs Differentiation into Alveolar Type II Cells for Acute Lung Injury Treatment in Mice | ||
J Ethnopharmacol Research on the mechanism of antidepressive effect of Suanzaoren Decoction through TLR4/MyD88/NF-κB pathway and Wnt/β-catenin pathway |
