Product Information
84577-1-PBS targets WNT3A in Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag25051 Product name: Recombinant human WNT3A protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 250-350 aa of BC103921 Sequence: RGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVSSHGIDGCDLLCCGRGHNARAERRREKCRCVFHWCCYVSCQECTRVYDVHT Predict reactive species |
| Full Name | wingless-type MMTV integration site family, member 3A |
| Calculated Molecular Weight | 352 aa, 39 kDa |
| GenBank Accession Number | BC103921 |
| Gene Symbol | WNT3A |
| Gene ID (NCBI) | 89780 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P56704 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
