WNT3A Recombinant monoclonal antibody, PBS Only

• 

  IF Staining of HepG2 using 84577-4-RR (same clone as 84577-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using WNT3A antibody (84577-4-RR, Clone: 241993E8 ) at dilution of 1:250 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 84577-4-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 84577-4-RR (same clone as 84577-4-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug WNT3A Recombinant antibody (84577-4-RR, Clone:241993E8) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 84577-4-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 84577-4-PBS

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug WNT3A Recombinant antibody, PBS Only (84577-4-PBS, Clone:241993E8) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  Affinity and Kinetic Characterization of 84577-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84577-4-RR against Human WNT3A were performed. The affinity constant is 4.67 nM.

WNT3A Uni-rAb^® Recombinant Antibody for IF/ICC, FC (Intra), Indirect ELISA

Cat No. 84577-4-PBS

Clone No.241993E8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra), Indirect ELISA

Synonyms

241993E8, Protein Wnt 3a, Protein Wnt-3a

---

Tested Applications

• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Product Information

84577-4-PBS targets WNT3A in IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag25051

  Product name: Recombinant human WNT3A protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 250-350 aa of BC103921

  Sequence: RGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVSSHGIDGCDLLCCGRGHNARAERRREKCRCVFHWCCYVSCQECTRVYDVHT

• Full Name: wingless-type MMTV integration site family, member 3A
• Calculated Molecular Weight: 352 aa, 39 kDa
• GenBank Accession Number: BC103921
• Gene Symbol: WNT3A
• Gene ID (NCBI): 89780
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P56704
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

WNT3A belongs to wingless-type MMTV integration site family, and abnormal Wnt signalling is often associated with severe human diseases, including cancer, osteoporosis and other degenerative disorders. WNT3A is a secreted glycoprotein that is involved in both canonical and non-canonical Wnt signaling pathways. The canonical Wnt pathway, also known as the β-catenin-dependent pathway, regulates gene expression by stabilizing β-catenin, which then translocates to the nucleus and interacts with transcription factors like TCF/LEF. It's shown to promote trophectoderm formation in embryonic stem cells. It's reported that the canonical Wnt/β-catenin signaling pathway also contributes to the carcinogenesis and progression of lung cancer cell lines. The non-canonical pathways, which are β-catenin-independent, are involved in cytoskeletal organization and cell polarity.