WRNIP1 Polyclonal antibody, PBS Only

• 

  WB analysis of human colon using 16238-1-AP (same clone as 16238-1-PBS)

  human colon tissue were subjected to SDS PAGE followed by western blot with 16238-1-AP (WRNIP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16238-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human kidney using 16238-1-AP (same clone as 16238-1-PBS)

  human kidney tissue were subjected to SDS PAGE followed by western blot with 16238-1-AP (WRNIP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16238-1-PBS in a different storage buffer formulation.

WRNIP1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 16238-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

16238-1-PBS targets WRNIP1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9040

  Product name: Recombinant human WRNIP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 293-640 aa of BC018923

  Sequence: VTLSATNAKTNDVRDVIKQAQNEKSFFKRKTILFIDEIHRFNKSQQVNAALLSRCRVIVLEKLPVEAMVTILMRAINSLGIHVLDSSRPTDPLSHSSNSSSEPAMFIEDKAVDTLAYLSDGDARAGLNGLQLAVLARLSSRKMFCKKSGQSYSPSRVLITENDVKEGLQRSHILYDRAGEEHYNCISALHKSMRGSDQNASLYWLARMLEGGEDPLYVARRLVRFASEDIGLADPSALTQAVAAYQGCHFIGMPECEVLLAQCVVYFARAPKSIEVYSAYNNVKACLRNHQGPLPPVPLHLRNAPTRLMKDLGYGKGYKYNPMYSEPVDQEYLPEELRGVDFFKQRRC

• Full Name: Werner helicase interacting protein 1
• Calculated Molecular Weight: 665aa,72 kDa; 640aa,69 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC018923
• Gene Symbol: WRNIP1
• Gene ID (NCBI): 56897
• RRID: AB_2288535
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96S55
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Human WRN-interacting protein 1 (WRNIP1) is a genome maintenance factor. Functions as a modulator of initiation or reinitiation events during DNA polymerase delta-mediated DNA synthesis. In the presence of ATP, stimulation of DNA polymerase delta-mediated DNA synthesis is decreased.