WRNIP1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• WRNIP1 Polyclonal antibody (16238-1-AP)

WRNIP1 Polyclonal Antibody for WB, ELISA

Cat No. 16238-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

ATPase WRNIP1, RP11 420G6.2, WHIP, WRNIP1

• 

  WB analysis of human colon using 16238-1-AP

  human colon tissue were subjected to SDS PAGE followed by western blot with 16238-1-AP (WRNIP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human kidney using 16238-1-AP

  human kidney tissue were subjected to SDS PAGE followed by western blot with 16238-1-AP (WRNIP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for WRNIP1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human colon tissue, human kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16238-1-AP targets WRNIP1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9040

  Product name: Recombinant human WRNIP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 293-640 aa of BC018923

  Sequence: VTLSATNAKTNDVRDVIKQAQNEKSFFKRKTILFIDEIHRFNKSQQVNAALLSRCRVIVLEKLPVEAMVTILMRAINSLGIHVLDSSRPTDPLSHSSNSSSEPAMFIEDKAVDTLAYLSDGDARAGLNGLQLAVLARLSSRKMFCKKSGQSYSPSRVLITENDVKEGLQRSHILYDRAGEEHYNCISALHKSMRGSDQNASLYWLARMLEGGEDPLYVARRLVRFASEDIGLADPSALTQAVAAYQGCHFIGMPECEVLLAQCVVYFARAPKSIEVYSAYNNVKACLRNHQGPLPPVPLHLRNAPTRLMKDLGYGKGYKYNPMYSEPVDQEYLPEELRGVDFFKQRRC

• Full Name: Werner helicase interacting protein 1
• Calculated Molecular Weight: 665aa,72 kDa; 640aa,69 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC018923
• Gene Symbol: WRNIP1
• Gene ID (NCBI): 56897
• RRID: AB_2288535
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96S55
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Human WRN-interacting protein 1 (WRNIP1) is a genome maintenance factor. Functions as a modulator of initiation or reinitiation events during DNA polymerase delta-mediated DNA synthesis. In the presence of ATP, stimulation of DNA polymerase delta-mediated DNA synthesis is decreased.

Publications

What published studies show

The WRNIP1 Polyclonal antibody (Cat# 16238-1-AP) has 1 total citation. It was cited in Nature Cell Biology (IF 22.7), in a 2025 study investigating how psychological stress-induced ALKBH5 deficiency promotes tumour innervation and pancreatic cancer through extracellular vesicle-mediated RNA transfer in mouse models. The associated research fields include pancreatic cancer, RNA biology, extracellular vesicles, and stress-related tumorigenesis.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Cell Biol; Psychological stress-induced ALKBH5 deficiency promotes tumour innervation and pancreatic cancer via extracellular vesicle transfer of RNA; Authors - Ziming Chen