WTAP Polyclonal antibody

• 

  WB analysis of HeLa using 10200-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 10200-1-AP (WTAP antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 10200-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 10200-1-AP (WTAP antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat cells using 10200-1-AP

  WB result of WTAP specific antibody (10200-1-AP, 1:6000) with si-control and si-WTAP transfected Jurkat cells.

• 

  WB analysis using 10200-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10200-1-AP (WTAP antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HEK-293 using 10200-1-AP

  IP result of anti-WTAP (IP:10200-1-AP, 3ug; Detection:10200-1-AP 1:500) with HEK-293 cells lysate 2500ug.

• 

  IP experiment of Jurkat using 10200-1-AP

  IP result of anti-WTAP (IP:10200-1-AP, 4ug; Detection:10200-1-AP 1:8000) with Jurkat cells lysate 2280 ug.

• 

  IHC staining of human stomach using 10200-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 10200-1-AP (WTAP antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 10200-1-AP

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 10200-1-AP (WTAP antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

WTAP Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 10200-1-AP

Publications(68)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, CoIP, RIP, ELISA

Synonyms

Wilms tumor 1-associating protein, Pre-mRNA-splicing regulator WTAP, Mum2, KIAA0105, FL2D

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells, HepG2 cells, MOLT-4 cells, L02 cells, K-562 cells
• Positive IP detected in: Jurkat cells, HEK-293 cells
• Positive IHC detected in: human intrahepatic cholangiocarcinoma tissue, human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 14 publications below
• WB: See 62 publications below
• IHC: See 3 publications below
• IF: See 8 publications below
• IP: See 2 publications below
• CoIP: See 1 publications below
• RIP: See 4 publications below

Product Information

10200-1-AP targets WTAP in WB, IHC, IF, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0259

  Product name: Recombinant human WTAP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2-150 aa of BC000383

  Sequence: TNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEEKLKQQQQESARRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKLEQAQNELSAWKFTPD

• Full Name: Wilms tumor 1 associated protein
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC000383
• Gene Symbol: WTAP
• Gene ID (NCBI): 9589
• RRID: AB_2216349
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15007
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

WTAP, also named as KIAA0105 and hFL(2)D, is previously identified as a protein associated with Wilms' tumor-1 (WT-1) protein that is essential for the development of the genitourinary system. It is a Pre-mRNA-splicing regulator protein. It is a regulatory subunit of the WMM N6-methyltransferase complex which plays a role in the efficiency of mRNA splicing and processing and mRNA stability. It is required for accumulation of METTL3 and METTL14 to nuclear speckle. MW of WTAP is 50-55 kDa due to phosphorylation.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nature; METTL3 regulates heterochromatin in mouse embryonic stem cells.; Authors - Wenqi Xu ; KD Validated
mouse	WB	Nature; m6A RNA methylation regulates the fate of endogenous retroviruses.; Authors - Tomasz Chelmicki ; KO Validated
mouse	WB	Cell Metab; Amelioration of nonalcoholic fatty liver disease by inhibiting the deubiquitylating enzyme RPN11; Authors - Bing Zhou
mouse	WB,RIP	Nat Cell Biol; The piRNA CHAPIR regulates cardiac hypertrophy by controlling METTL3-dependent N6-methyladenosine methylation of Parp10 mRNA.; Authors - Xiang-Qian Gao
human	WB	Mol Cell; Dynamic control of chromatin-associated m6A methylation regulates nascent RNA synthesis.; Authors - Wenqi Xu ; KD Validated
mouse	WB,IF	Mol Cell; Zc3h13 Regulates Nuclear RNA m6A Methylation and Mouse Embryonic Stem Cell Self-Renewal.; Authors - Jing Wen