Tested Applications
Positive WB detected in | human placenta tissue |
Positive IHC detected in | human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
27049-1-AP targets XKRX in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25266 Product name: Recombinant human XKRX protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 101-210 aa of BC137010 Sequence: VHRDLAKDKPLSLFMHLILLGPVIRCLEAMIKYLTLWKKEEQEEPYVSLTRKKMLIDGEEVLIEWEVGHSIRTLAMHRNAYKRMSQIQAFLGSVPQLTYQLYVSLISAEV Predict reactive species |
Full Name | XK, Kell blood group complex subunit-related, X-linked |
Calculated Molecular Weight | 462 aa, 54 kDa |
Observed Molecular Weight | 30 kDa |
GenBank Accession Number | BC137010 |
Gene Symbol | XKRX |
Gene ID (NCBI) | 402415 |
RRID | AB_2880732 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q6PP77 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
XKRX (XK-associated X-linked protein) is a component of the XK/Kell complex in the Kell blood group system, encoding a membrane protein with multiple transmembrane domains that is exposed on the cell surface and may function as a membrane transport protein. It is expressed predominantly in the placenta and syncytiotrophoblasts. It has 2 isoforms, with molecular weights of 52 kDa and 28 kDa respectively. Its function has not been fully clarified yet.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for XKRX antibody 27049-1-AP | Download protocol |
IHC protocol for XKRX antibody 27049-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |