XPO5 Polyclonal antibody

• 

  WB analysis using 28628-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28628-1-AP (XPO5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse testis using 28628-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 28628-1-AP (XPO5 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 28628-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 28628-1-AP (XPO5 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

XPO5 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28628-1-AP

Publications(2)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse and More (1)

Applications

WB, IHC, ELISA

Synonyms

Exp5, exportin 5, FLJ14239, FLJ32057, FLJ45606, KIAA1291, Ran binding protein 21, RANBP21, XPO5

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, K-562 cells
• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

28628-1-AP targets XPO5 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse samples.

• Tested Reactivity: Human, Mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24217

  Product name: Recombinant human XPO5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-100 aa of BC000129

  Sequence: MRLSQKWQVINQRSLLCGEDEAADENPESQEMLEEQLVRMLTREVMDLITVCCVSKKGADHSSAPPADGDDEEMMATEVTPSAMAELTDLGKCLMKHEDV

• Full Name: exportin 5
• Calculated Molecular Weight: 136 kDa
• Observed Molecular Weight: 136 kDa
• GenBank Accession Number: BC000129
• Gene Symbol: XPO5
• Gene ID (NCBI): 57510
• RRID: AB_2881184
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HAV4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	ACS Chem Biol; Amyotrophic Lateral Sclerosis-Associated Mutants of SOD1 Modulate miRNA Biogenesis through Aberrant Interactions with Exportin 5; Authors - Xingyuan Chen
		Ecotoxicol Environ Saf; Soybean isoflavones protect dopaminergic neurons from atrazine damage by inhibiting VPS13A to increase autophagy; Authors - Peng Li

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Xingyuan (Verified Customer) (06-22-2023)

Quality of the antibody was good.

• Applications: Western Blot
• Primary Antibody Dilution: 1:2000
• Cell Tissue Type: 293T

XPO5 Antibody Western Blot validation (1:2000 dilution) in 293T (Cat no:28628-1-AP)