Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, K-562 cells, NIH/3T3 cells, mouse brain tissue, rat brain tissue |
| Positive IHC detected in | mouse testis tissue, mouse adrenal gland tissue, human placenta tissue, rat adrenal gland tissue, human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28628-1-AP targets XPO5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24217 Product name: Recombinant human XPO5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC000129 Sequence: MRLSQKWQVINQRSLLCGEDEAADENPESQEMLEEQLVRMLTREVMDLITVCCVSKKGADHSSAPPADGDDEEMMATEVTPSAMAELTDLGKCLMKHEDV Predict reactive species |
| Full Name | exportin 5 |
| Calculated Molecular Weight | 136 kDa |
| Observed Molecular Weight | 136 kDa |
| GenBank Accession Number | BC000129 |
| Gene Symbol | XPO5 |
| Gene ID (NCBI) | 57510 |
| RRID | AB_2881184 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9HAV4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for XPO5 antibody 28628-1-AP | Download protocol |
| WB protocol for XPO5 antibody 28628-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Antibody 28628-1-AP (anti-XPO5/Exportin 5) has 3 total citations appearing in Nucleic Acids Research, Ecotoxicology and Environmental Safety, and ACS Chemical Biology. Associated research fields include pre-miRNA nuclear export regulation, dopaminergic neuron protection through autophagy inhibition of VPS13A, and ALS-associated SOD1 mutant modulation of miRNA biogenesis.
| Species | Application | Title |
|---|---|---|
Ecotoxicol Environ Saf Soybean isoflavones protect dopaminergic neurons from atrazine damage by inhibiting VPS13A to increase autophagy | ||
ACS Chem Biol Amyotrophic Lateral Sclerosis-Associated Mutants of SOD1 Modulate miRNA Biogenesis through Aberrant Interactions with Exportin 5 |
Reviews
What customers say
One customer review is available for this product. The reviewer, Xingyuan Chen, rated it 5 stars after using it for Western Blot on 293T cells at a 1:2000 dilution (Lot 00089128). They reported that the quality of the antibody was good. Overall, the limited feedback is positive, with the user expressing satisfaction with the antibody's performance in their application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Xingyuan (Verified Customer) (06-22-2023) | Quality of the antibody was good.
 |
