XPO5 Polyclonal antibody, PBS Only

• 

  WB analysis using 28628-1-AP (same clone as 28628-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28628-1-AP (XPO5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28628-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 28628-1-AP (same clone as 28628-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 28628-1-AP (XPO5 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28628-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 28628-1-AP (same clone as 28628-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 28628-1-AP (XPO5 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28628-1-PBS in a different storage buffer formulation.

XPO5 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 28628-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

28628-1-PBS targets XPO5 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24217

  Product name: Recombinant human XPO5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-100 aa of BC000129

  Sequence: MRLSQKWQVINQRSLLCGEDEAADENPESQEMLEEQLVRMLTREVMDLITVCCVSKKGADHSSAPPADGDDEEMMATEVTPSAMAELTDLGKCLMKHEDV

• Full Name: exportin 5
• Calculated Molecular Weight: 136 kDa
• Observed Molecular Weight: 136 kDa
• GenBank Accession Number: BC000129
• Gene Symbol: XPO5
• Gene ID (NCBI): 57510
• RRID: AB_2881184
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HAV4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.