Product Information
18418-1-AP targets YPEL4 in ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag11452 Product name: Recombinant human YPEL4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-62 aa of BC029228 Sequence: MPSCDPGPGPACLPTKTFRSYLPRCHRTYSCVHCRAHLAKHDELISKSFQGSHGRAYLFNSV Predict reactive species |
| Full Name | yippee-like 4 (Drosophila) |
| Calculated Molecular Weight | 62aa,7 kDa; 127aa,14 kDa |
| GenBank Accession Number | BC029228 |
| Gene Symbol | YPEL4 |
| Gene ID (NCBI) | 219539 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96NS1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
