Use Able AI chat for product recommendations

YTHDF1 / YTHDF2 Monoclonal antibody

YTHDF1 / YTHDF2 Monoclonal Antibody for WB, ELISA

Cat No. 68416-1-Ig
Clone No.2F5H2

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse , rat

Applications

WB, ELISA

CLL associated antigen KW 14, HGRG8, NY REN 2, YTH domain family protein 2, YTH domain family, member 2, YTHDF2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inLNCaP cells, NIH/3T3 cells, HeLa cells, HEK-293 cells, Jurkat cells, 4T1 cells, HSC-T6 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68416-1-Ig targets YTHDF1 / YTHDF2 in WB, ELISA applications and shows reactivity with Human, mouse , rat samples.

Tested Reactivity Human, mouse , rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag5922

Product name: Recombinant human YTHDF2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 339-565 aa of BC002559

Sequence: LSVQQQAAQPTRWVAPRNRGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNYNPKDFDWNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQE

Predict reactive species
Full Name YTH domain family, member 2
Calculated Molecular Weight 62 kDa
Observed Molecular Weight63 kDa, 70 kDa
GenBank Accession NumberBC002559
Gene Symbol YTHDF2
Gene ID (NCBI) 51441
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9Y5A9
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

YTHDF2, also named as YTH domain-containing family protein 2, is a 579 amino acid protein, which contains 1 YTH domain. YTHDF2 specifically recognizes and binds N6-methyladenosine (m6A)-containing RNAs, and regulates mRNA stability. M6A is a modification present at internal sites of mRNAs and some non-coding RNAs and plays a role in the efficiency of mRNA splicing, processing and stability. YTHDF2 acts as a regulator of mRNA stability: binding to m6A-containing mRNAs results in the localization to mRNA decay sites, such as processing bodies (P-bodies), leading to mRNA degradation. YTHDF2 also acts as a promoter of cap-independent mRNA translation following heat shock stress: upon stress, relocalizes to the nucleus and specifically binds mRNAs with some m6A methylation mark at their 5'-UTR, protecting demethylation of mRNAs by FTO, thereby promoting cap-independent mRNA translation. The calculated molecular weight of YTHDF2 is 62 kDa, but the phosphorylated YTHDF2 is about 65-70 kDa.

Loading...
||
New chat

Able

正在加载,请稍候...