Tested Applications
| Positive WB detected in | HEK-293 cells, Jurkat cells, HeLa cells, Raji cells, NIH/3T3 cells, RAW 264.7 cells, C6 cells |
| Positive IP detected in | HeLa cells |
| Positive IF/ICC detected in | sodium arsenite treated HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
81340-1-RR targets YTHDF2 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag5922 Product name: Recombinant human YTHDF2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 339-565 aa of BC002559 Sequence: LSVQQQAAQPTRWVAPRNRGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNYNPKDFDWNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQE Predict reactive species |
| Full Name | YTH domain family, member 2 |
| Calculated Molecular Weight | 62 kDa |
| Observed Molecular Weight | 65-70 kDa |
| GenBank Accession Number | BC002559 |
| Gene Symbol | YTHDF2 |
| Gene ID (NCBI) | 51441 |
| RRID | AB_2923715 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9Y5A9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
YTHDF2, also named as YTH domain-containing family protein 2, is a 579 amino acid protein, which contains 1 YTH domain. YTHDF2 specifically recognizes and binds N6-methyladenosine (m6A)-containing RNAs, and regulates mRNA stability. M6A is a modification present at internal sites of mRNAs and some non-coding RNAs and plays a role in the efficiency of mRNA splicing, processing and stability. YTHDF2 acts as a regulator of mRNA stability: binding to m6A-containing mRNAs results in the localization to mRNA decay sites, such as processing bodies (P-bodies), leading to mRNA degradation. YTHDF2 also acts as a promoter of cap-independent mRNA translation following heat shock stress: upon stress, relocalizes to the nucleus and specifically binds mRNAs with some m6A methylation mark at their 5'-UTR, protecting demethylation of mRNAs by FTO, thereby promoting cap-independent mRNA translation. The calculated molecular weight of YTHDF2 is 62 kDa, but the phosphorylated YTHDF2 is about 65-70 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for YTHDF2 antibody 81340-1-RR | Download protocol |
| IP protocol for YTHDF2 antibody 81340-1-RR | Download protocol |
| WB protocol for YTHDF2 antibody 81340-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The YTHDF2 Recombinant monoclonal antibody (3L6), catalog number 81340-1-RR, has 3 total citations. These appear in Journal of Advanced Research, Experimental Cell Research, and Nature Metabolism. The associated research fields include pulmonary fibrosis and cuproptosis (m6A/STAT6 axis), colorectal cancer progression (m6A modification and YTHDF2 function), and cold-induced thermogenesis (ALKBH5-mediated CKB mRNA stabilization). Applications cited include Western blot and immunoprecipitation in human and mouse samples.
| Species | Application | Title |
|---|---|---|
J Adv Res Targeting myofibroblast copper vulnerability reverses pulmonary fibrosis via METTL3-directed STAT6 m6A driving cuproptosis. | ||
Exp Cell Res K542 Acetylation Promotes YTHDF2 Binding to m6A-modified mRNAs and Fosters Colorectal Cancer Progression
| ||
Nat Metab ALKBH5 activates creatine-driven thermogenesis by stabilizing CKB mRNA in response to cold. |
Reviews
What customers say
One reviewer (Nikolett P.) gave a 5-star rating, reporting that the antibody performed well in Western Blot, IHC, and IF. She used a 1:1000 dilution for WB with various human lung cancer cell lines, and 1:300 for IHC and IF on human NSCLC patient samples. Overall, the feedback is positive, confirming reliable performance across multiple applications in human lung cancer samples.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Nikolett (Verified Customer) (07-23-2025) | Antibody works well as 1:1000 for Western Blot, 1:300 for IHC and IF. For Western Blot I used various human lung cancer cell lines. For IHC and IF I used human NSCLC patient samples.
|
