• Featured Product
  • KD/KO Validated

YTHDF2 Recombinant monoclonal antibody

YTHDF2 Uni-rAb® Recombinant Antibody for WB, IF/ICC, IP, ELISA
Cat No. 81340-1-RR
Clone No.3L6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, ELISA

3L6, CLL associated antigen KW 14, CLL-associated antigen KW-14, DF2, HGRG8

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, Jurkat cells, HeLa cells, Raji cells, NIH/3T3 cells, RAW 264.7 cells, C6 cells
Positive IP detected inHeLa cells
Positive IF/ICC detected insodium arsenite treated HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:10000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

81340-1-RR targets YTHDF2 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag5922

Product name: Recombinant human YTHDF2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 339-565 aa of BC002559

Sequence: LSVQQQAAQPTRWVAPRNRGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNYNPKDFDWNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQE

Predict reactive species
Full Name YTH domain family, member 2
Calculated Molecular Weight 62 kDa
Observed Molecular Weight 65-70 kDa
GenBank Accession NumberBC002559
Gene Symbol YTHDF2
Gene ID (NCBI) 51441
RRIDAB_2923715
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9Y5A9
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

YTHDF2, also named as YTH domain-containing family protein 2, is a 579 amino acid protein, which contains 1 YTH domain. YTHDF2 specifically recognizes and binds N6-methyladenosine (m6A)-containing RNAs, and regulates mRNA stability. M6A is a modification present at internal sites of mRNAs and some non-coding RNAs and plays a role in the efficiency of mRNA splicing, processing and stability. YTHDF2 acts as a regulator of mRNA stability: binding to m6A-containing mRNAs results in the localization to mRNA decay sites, such as processing bodies (P-bodies), leading to mRNA degradation. YTHDF2 also acts as a promoter of cap-independent mRNA translation following heat shock stress: upon stress, relocalizes to the nucleus and specifically binds mRNAs with some m6A methylation mark at their 5'-UTR, protecting demethylation of mRNAs by FTO, thereby promoting cap-independent mRNA translation. The calculated molecular weight of YTHDF2 is 62 kDa, but the phosphorylated YTHDF2 is about 65-70 kDa.

Protocols

Product Specific Protocols
WB protocol for YTHDF2 antibody 81340-1-RRDownload protocol
IF protocol for YTHDF2 antibody 81340-1-RRDownload protocol
IP protocol for YTHDF2 antibody 81340-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Nikolett (Verified Customer) (07-23-2025)

Antibody works well as 1:1000 for Western Blot, 1:300 for IHC and IF. For Western Blot I used various human lung cancer cell lines. For IHC and IF I used human NSCLC patient samples.

  • Applications: Western Blot, Immunohistochemistry, Immunofluorescence
  • Primary Antibody Dilution: 1:1000 for Western Blot, 1:300 for IHC and IF
  • Cell Tissue Type: Human Lung Cancer Patient Samples
Loading...
||
New chat Able
正在加载,请稍候...