• Featured Product
  • KD/KO Validated

YTHDF2 Recombinant monoclonal antibody

YTHDF2 Uni-rAb® Recombinant Antibody for WB, IF/ICC, IP, ELISA
Cat No. 81340-1-RR
Clone No.3L6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, ELISA

3L6, CLL associated antigen KW 14, CLL-associated antigen KW-14, DF2, HGRG8

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, Jurkat cells, HeLa cells, Raji cells, NIH/3T3 cells, RAW 264.7 cells, C6 cells
Positive IP detected inHeLa cells
Positive IF/ICC detected insodium arsenite treated HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:10000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

81340-1-RR targets YTHDF2 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag5922

Product name: Recombinant human YTHDF2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 339-565 aa of BC002559

Sequence: LSVQQQAAQPTRWVAPRNRGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNYNPKDFDWNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQE

Predict reactive species
Full Name YTH domain family, member 2
Calculated Molecular Weight 62 kDa
Observed Molecular Weight 65-70 kDa
GenBank Accession NumberBC002559
Gene Symbol YTHDF2
Gene ID (NCBI) 51441
RRIDAB_2923715
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9Y5A9
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

YTHDF2, also named as YTH domain-containing family protein 2, is a 579 amino acid protein, which contains 1 YTH domain. YTHDF2 specifically recognizes and binds N6-methyladenosine (m6A)-containing RNAs, and regulates mRNA stability. M6A is a modification present at internal sites of mRNAs and some non-coding RNAs and plays a role in the efficiency of mRNA splicing, processing and stability. YTHDF2 acts as a regulator of mRNA stability: binding to m6A-containing mRNAs results in the localization to mRNA decay sites, such as processing bodies (P-bodies), leading to mRNA degradation. YTHDF2 also acts as a promoter of cap-independent mRNA translation following heat shock stress: upon stress, relocalizes to the nucleus and specifically binds mRNAs with some m6A methylation mark at their 5'-UTR, protecting demethylation of mRNAs by FTO, thereby promoting cap-independent mRNA translation. The calculated molecular weight of YTHDF2 is 62 kDa, but the phosphorylated YTHDF2 is about 65-70 kDa.

Protocols

Product Specific Protocols
IF protocol for YTHDF2 antibody 81340-1-RRDownload protocol
IP protocol for YTHDF2 antibody 81340-1-RRDownload protocol
WB protocol for YTHDF2 antibody 81340-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IP

Exp Cell Res

K542 Acetylation Promotes YTHDF2 Binding to m6A-modified mRNAs and Fosters Colorectal Cancer Progression

Authors - Bo Wen
  • KD Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Nikolett (Verified Customer) (07-23-2025)

Antibody works well as 1:1000 for Western Blot, 1:300 for IHC and IF. For Western Blot I used various human lung cancer cell lines. For IHC and IF I used human NSCLC patient samples.

  • Applications: Western Blot, Immunohistochemistry, Immunofluorescence
  • Primary Antibody Dilution: 1:1000 for Western Blot, 1:300 for IHC and IF
  • Cell Tissue Type: Human Lung Cancer Patient Samples
Loading...
||
New chat Able
正在加载,请稍候...