• Featured Product
  • KD/KO Validated

YTHDF2 Recombinant monoclonal antibody, PBS Only

YTHDF2 Uni-rAb® Recombinant Antibody for WB, IF/ICC, IP, Indirect ELISA
Cat No. 81340-1-PBS
Clone No.3L6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, Indirect ELISA

3L6, CLL associated antigen KW 14, CLL-associated antigen KW-14, DF2, HGRG8

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

81340-1-PBS targets YTHDF2 in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag5922

Product name: Recombinant human YTHDF2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 339-565 aa of BC002559

Sequence: LSVQQQAAQPTRWVAPRNRGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNYNPKDFDWNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQE

Predict reactive species
Full Name YTH domain family, member 2
Calculated Molecular Weight 62 kDa
Observed Molecular Weight 65-70 kDa
GenBank Accession NumberBC002559
Gene Symbol YTHDF2
Gene ID (NCBI) 51441
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9Y5A9
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

YTHDF2, also named as YTH domain-containing family protein 2, is a 579 amino acid protein, which contains 1 YTH domain. YTHDF2 specifically recognizes and binds N6-methyladenosine (m6A)-containing RNAs, and regulates mRNA stability. M6A is a modification present at internal sites of mRNAs and some non-coding RNAs and plays a role in the efficiency of mRNA splicing, processing and stability. YTHDF2 acts as a regulator of mRNA stability: binding to m6A-containing mRNAs results in the localization to mRNA decay sites, such as processing bodies (P-bodies), leading to mRNA degradation. YTHDF2 also acts as a promoter of cap-independent mRNA translation following heat shock stress: upon stress, relocalizes to the nucleus and specifically binds mRNAs with some m6A methylation mark at their 5'-UTR, protecting demethylation of mRNAs by FTO, thereby promoting cap-independent mRNA translation. The calculated molecular weight of YTHDF2 is 62 kDa, but the phosphorylated YTHDF2 is about 65-70 kDa.

Loading...
||
New chat Able
正在加载,请稍候...