YTHDF2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 81340-1-RR (same clone as 81340-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 81340-1-RR (YTHDF2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 81340-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 81340-1-RR (same clone as 81340-1-PBS)

  WB result of YTHDF2 antibody (81340-1-RR; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-YTHDF2 transfected Jurkat cells. This data was developed using the same antibody clone with 81340-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 81340-1-RR (same clone as 81340-1-PBS)

  IP result of anti-YTHDF2 (IP:81340-1-RR, 4ug; Detection:81340-1-RR 1:1000) with HeLa cells lysate 1880 ug. This data was developed using the same antibody clone with 81340-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 81340-1-RR (same clone as 81340-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed sodium arsenite treated HeLa cells using YTHDF2 antibody (81340-1-RR, Clone: 3L6 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 81340-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 81340-1-RR

  Biolayer interferometry (BLl) kinetic assays of 81340-1-RR against Human YTHDF2 were performed. The affinity constant is 41.6 pM.

• Featured Product
• KD/KO Validated

YTHDF2 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 81340-1-PBS

Clone No.3L6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

3L6, CLL associated antigen KW 14, CLL-associated antigen KW-14, DF2, HGRG8

---

Product Information

81340-1-PBS targets YTHDF2 in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5922

  Product name: Recombinant human YTHDF2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 339-565 aa of BC002559

  Sequence: LSVQQQAAQPTRWVAPRNRGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNYNPKDFDWNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQE

• Full Name: YTH domain family, member 2
• Calculated Molecular Weight: 62 kDa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC002559
• Gene Symbol: YTHDF2
• Gene ID (NCBI): 51441
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y5A9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

YTHDF2, also named as YTH domain-containing family protein 2, is a 579 amino acid protein, which contains 1 YTH domain. YTHDF2 specifically recognizes and binds N6-methyladenosine (m6A)-containing RNAs, and regulates mRNA stability. M6A is a modification present at internal sites of mRNAs and some non-coding RNAs and plays a role in the efficiency of mRNA splicing, processing and stability. YTHDF2 acts as a regulator of mRNA stability: binding to m6A-containing mRNAs results in the localization to mRNA decay sites, such as processing bodies (P-bodies), leading to mRNA degradation. YTHDF2 also acts as a promoter of cap-independent mRNA translation following heat shock stress: upon stress, relocalizes to the nucleus and specifically binds mRNAs with some m6A methylation mark at their 5'-UTR, protecting demethylation of mRNAs by FTO, thereby promoting cap-independent mRNA translation. The calculated molecular weight of YTHDF2 is 62 kDa, but the phosphorylated YTHDF2 is about 65-70 kDa.