YWHAZ Polyclonal antibody, PBS Only

• 

  WB analysis using 14881-1-AP (same clone as 14881-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14881-1-AP (YWHAZ antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14881-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 14881-1-AP (same clone as 14881-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 14881-1-AP (YWHAZ antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14881-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 14881-1-AP (same clone as 14881-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14881-1-AP (YWHAZ antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14881-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 14881-1-AP (same clone as 14881-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14881-1-AP (YWHAZ antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14881-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 14881-1-AP (same clone as 14881-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14881-1-AP (YWHAZ antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14881-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin cancer using 14881-1-AP (same clone as 14881-1-PBS)

  Immunohistochemical analysis of paraffin-embedded skin cancer slide using 14881-1-AP (YWHAZ antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14881-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

YWHAZ Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 14881-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

14-3-3, 14-3-3 protein zeta/delta, KCIP 1, KCIP-1

---

Product Information

14881-1-PBS targets YWHAZ in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6654

  Product name: Recombinant human YWHAZ protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-245 aa of BC003623

  Sequence: MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN

• Full Name: tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 28-30 kDa
• GenBank Accession Number: BC003623
• Gene Symbol: YWHAZ
• Gene ID (NCBI): 7534
• RRID: AB_2218248
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P63104
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

YWHAZ (also known as 14-3-3 zeta) is a member of 14-3-3 proteins which were the first phosphoserine/phosphothreonine-binding proteins to be discovered. 14-3-3 family members interact with a wide spectrum of proteins and possess diverse functions. Mammals express seven distinct 14-3-3 isoforms (gamma, epsilon, beta, zeta, sigma, theta, tau) that form multiple homo- and hetero- dimmers. 14-3-3 proteins display the highest expression levels in the brain, and have been implicated in several neurodegenerative diseases, including Alzheimer's disease and amyotrophic lateral sclerosis. This antibody was raised against the full-length YWHAZ.