YWHAZ Monoclonal antibody

YWHAZ Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 67698-1-Ig
Clone No.3G12B10

Host / Isotype

Mouse / IgM

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

14-3-3, 14-3-3 protein zeta/delta, 3G12B10, KCIP 1, KCIP-1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, HSC-T6 cells, PC-12 cells, NIH3T3 cells, RAW 264.7 cells
Positive IHC detected inhuman lung cancer tissue, human liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMCF-7 cells
Positive FC (Intra) detected inA549 cells

Mouse monoclonal antibodies of IgM isotype can be detected with "anti-mouse IgG (H+L)" secondary antibodies.

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.2 μg per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67698-1-Ig targets YWHAZ in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgM
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6667

Product name: Recombinant human YWHAZ protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-245 aa of BC003623

Sequence: MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN

Predict reactive species
Full Name tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide
Calculated Molecular Weight 28 kDa
Observed Molecular Weight28-30 kDa
GenBank Accession NumberBC003623
Gene Symbol YWHAZ
Gene ID (NCBI) 7534
RRIDAB_2882890
Conjugate Unconjugated
FormLiquid
Purification MethodCaprylic acid/ammonium sulfate precipitation
UNIPROT IDP63104
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

YWHAZ (also known as 14-3-3 zeta) is a member of 14-3-3 proteins which were the first phosphoserine/phosphothreonine-binding proteins to be discovered. 14-3-3 family members interact with a wide spectrum of proteins and possess diverse functions. Mammals express seven distinct 14-3-3 isoforms (gamma, epsilon, beta, zeta, sigma, theta, tau) that form multiple homo- and hetero- dimmers. 14-3-3 proteins display the highest expression levels in the brain, and have been implicated in several neurodegenerative diseases, including Alzheimer's disease and amyotrophic lateral sclerosis.

Protocols

Product Specific Protocols
IF protocol for YWHAZ antibody 67698-1-IgDownload protocol
IHC protocol for YWHAZ antibody 67698-1-IgDownload protocol
WB protocol for YWHAZ antibody 67698-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...