YWHAZ Monoclonal antibody

• Home
• Products
• Primary Antibodies
• YWHAZ Monoclonal antibody (67698-1-Ig)

YWHAZ Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67698-1-Ig Copied!

Clone No. 3G12B10

Publications (3)

Download datasheet

Host / Isotype

Mouse / IgM

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, CoIP, ELISA
For FC, select conjugated version.

Synonyms

14-3-3, 14-3-3 protein zeta/delta, 3G12B10, KCIP 1, KCIP-1

• 

  WB analysis using 67698-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67698-1-Ig (YWHAZ antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 67698-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 67698-1-Ig (YWHAZ antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 67698-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67698-1-Ig (YWHAZ antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 67698-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using YWHAZ antibody (67698-1-Ig, Clone: 3G12B10 ) at dilution of 1:500 and Multi-rAb CoraLite® Plus 594-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (Cat.NO. RGAM004 ).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 67698-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using YWHAZ antibody (67698-1-Ig, Clone: 3G12B10 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of A549 using 67698-1-Ig

  1x10^6 A549 cells were intracellularly stained with 0.2 μg YWHAZ Monoclonal antibody (67698-1-Ig, Clone:3G12B10) and Multi-rAb CoraLite® Plus 647-Goat Anti-Mouse Recombinant Secondary Antibody (H+L)(RGAM005), and 0.2 μg Mouse IgM Isotype Control (65243-1-Ig, Clone: MOPC-104E) was parallel stained as control. Cells were fixed with 4% PFA .

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for YWHAZ in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, HSC-T6 cells, PC-12 cells, NIH3T3 cells, RAW 264.7 cells
• Positive IHC detected in: human lung cancer tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells, HeLa cells
• Positive FC (Intra) detected in: A549 cells

Mouse monoclonal antibodies of IgM isotype can be detected with "anti-mouse IgG (H+L)" secondary antibodies.

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.2 μg per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67698-1-Ig targets YWHAZ in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, rat
• Host / Isotype: Mouse / IgM
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6667

  Product name: Recombinant human YWHAZ protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-245 aa of BC003623

  Sequence: MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN

• Full Name: tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 28-30 kDa
• GenBank Accession Number: BC003623
• Gene Symbol: YWHAZ
• Gene ID (NCBI): 7534
• RRID: AB_2882890
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Caprylic acid/ammonium sulfate precipitation
• UNIPROT ID: P63104
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

YWHAZ (also known as 14-3-3 zeta) is a member of 14-3-3 proteins which were the first phosphoserine/phosphothreonine-binding proteins to be discovered. 14-3-3 family members interact with a wide spectrum of proteins and possess diverse functions. Mammals express seven distinct 14-3-3 isoforms (gamma, epsilon, beta, zeta, sigma, theta, tau) that form multiple homo- and hetero- dimmers. 14-3-3 proteins display the highest expression levels in the brain, and have been implicated in several neurodegenerative diseases, including Alzheimer's disease and amyotrophic lateral sclerosis.

Publications

What published studies show

The YWHAZ Monoclonal antibody (3G12B10), catalog number 67698-1-Ig, has a total of 3 citations. These appear in mSphere, Journal of Neurological Sciences, and Forensic Toxicology. The associated research fields include innate immunity and RNA virus signaling (IRF3 pathway), neurodegenerative disease biomarker discovery (multiple system atrophy-parkinsonism), and hepatic gluconeogenesis in insulin overdose-related liver injury.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF,CoIP	mSphere; YWHAZ downregulated innate immune responses to RNA viruses by inhibiting the IRF3 signaling pathway.; Authors - Shasha Li ; KO Validated
human	WB	J Neurol Sci; Cerebrospinal fluid HOMER1 and NPTX2 as candidate signatures in early-stage multiple system atrophy-parkinsonism.; Authors - Saki Hatakeyama
rat	IHC,IF	Forensic Toxicol; Study on the expression changes of hepatic Gluconeogenesis-related proteins induced by insulin Overdose-related liver injury.; Authors - Yuhao Yuan