CoraLite® Plus 488-conjugated YWHAZ Monoclonal antibody

• 

  IF Staining of MCF-7 using CL488-67698

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using CoraLite® Plus 488 YWHAZ antibody (CL488-67698, Clone: 3G12B10 ) at dilution of 1:200.

• 

  FC experiment of MCF-7 using CL488-67698

  1x10^6 MCF-7 cells were intracellularly stained with 0.4 ug CoraLite® Plus 488-conjugated YWHAZ Monoclonal antibody (CL488-67698, Clone:3G12B10)(red), or 0.4 ug Isotype Control (CL488-66360-1) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

YWHAZ Monoclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-67698

Clone No.3G12B10

Host / Isotype

Mouse / IgM

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

Synonyms

14-3-3, 14-3-3 protein zeta/delta, 3G12B10, KCIP 1, KCIP-1

---

Tested Applications

• Positive IF/ICC detected in: MCF-7 cells
• Positive FC (Intra) detected in: MCF-7 cells

Mouse monoclonal antibodies of IgM isotype can be detected with "anti-mouse IgG (H+L)" secondary antibodies.

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67698 targets YWHAZ in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgM
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6667

  Product name: Recombinant human YWHAZ protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-245 aa of BC003623

  Sequence: MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN

• Full Name: tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 28-30 kDa
• GenBank Accession Number: BC003623
• Gene Symbol: YWHAZ
• Gene ID (NCBI): 7534
• RRID: AB_3672959
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Caprylic acid/ammonium sulfate precipitation
• UNIPROT ID: P63104
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

YWHAZ (also known as 14-3-3 zeta) is a member of 14-3-3 proteins which were the first phosphoserine/phosphothreonine-binding proteins to be discovered. 14-3-3 family members interact with a wide spectrum of proteins and possess diverse functions. Mammals express seven distinct 14-3-3 isoforms (gamma, epsilon, beta, zeta, sigma, theta, tau) that form multiple homo- and hetero- dimmers. 14-3-3 proteins display the highest expression levels in the brain, and have been implicated in several neurodegenerative diseases, including Alzheimer's disease and amyotrophic lateral sclerosis.