Tested Applications
Positive WB detected in | HeLa cells, Jurkat cells, MDA-MB-231 cells |
Positive IHC detected in | human colon cancer tissue, rat tongue tissue, mouse tongue tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:6000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 3 publications below |
IF | See 1 publications below |
Product Information
28761-1-AP targets ZAK in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag30599 Product name: Recombinant human ZAK protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 223-325 aa of BC001401 Sequence: ERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNKAEWRCEIEATLERLKKLERDLSFKEQELKERERRLKMWEQKLTEQ Predict reactive species |
Full Name | sterile alpha motif and leucine zipper containing kinase AZK |
Calculated Molecular Weight | 91 kDa |
Observed Molecular Weight | 91kDa, 51 kDa |
GenBank Accession Number | BC001401 |
Gene Symbol | ZAK |
Gene ID (NCBI) | 51776 |
RRID | AB_2918199 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9NYL2 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ZAK(sterile-alpha motif and leucine zipper containing kinase AZK) is also named as MLTK, MAPKKK, mlklak, MLK7, AZK, MLT, MRK, HCCS-4, MAP3K20 and belongs to the MAPKKK family. It is a mitogen-activated protein kinase kinase kinase (MAP3K) that activates the stress-activated protein kinase/c-jun N-terminal kinase pathway and activates NF-kappaB. ZAK contributes to regulation of DNA damage checkpoints through a p38gamma-independent pathway. This protein has 3 isoforms produced by alternative splicing with the MW of 91 kDa, 51 kDa and 35 kDa.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ZAK antibody 28761-1-AP | Download protocol |
IHC protocol for ZAK antibody 28761-1-AP | Download protocol |
IF protocol for ZAK antibody 28761-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Genome Biol The collateral activity of RfxCas13d can induce lethality in a RfxCas13d knock-in mouse model
| ||
J Cell Mol Med Linoleic Acid Enhances Renal Tubular Epithelial Cells Autophagy Caused by Calcium Oxalate Monohydrate Crystals | ||
Inflammation ZAKα Induces Pyroptosis of Colonic Epithelium Via the Caspase-11/GSDMD Pathway to Aggravate Colitis |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Troy (Verified Customer) (10-02-2025) | Western on mouse skeletal muscle and liver lysates was superb. Detected alpha and beta isoforms in skeletal muscle and liver as expected
|