ZAK Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 81161-2-RR (same clone as 81161-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 81161-2-RR (ZAK antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 81161-2-PBS in a different storage buffer formulation.

• 

  WB analysis using 81161-2-RR (same clone as 81161-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 81161-2-RR (ZAK antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 81161-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 81161-2-RR

  Biolayer interferometry (BLl) kinetic assays of 81161-2-RR against Human ZAK were performed. The affinity constant is 0.28 nM.

ZAK Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 81161-2-PBS

Clone No.250559E6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

AZK, EC:2.7.11.25, HCCS 4, HCCS-4, Leucine zipper- and sterile alpha motif-containing kinase

---

Product Information

81161-2-PBS targets ZAK in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag30599

  Product name: Recombinant human ZAK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 223-325 aa of BC001401

  Sequence: ERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNKAEWRCEIEATLERLKKLERDLSFKEQELKERERRLKMWEQKLTEQ

• Full Name: sterile alpha motif and leucine zipper containing kinase AZK
• Calculated Molecular Weight: 91 kDa
• Observed Molecular Weight: 91kDa, 51 kDa
• GenBank Accession Number: BC001401
• Gene Symbol: ZAK
• Gene ID (NCBI): 51776
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NYL2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ZAK(sterile-alpha motif and leucine zipper containing kinase AZK) is also named as MLTK, MAPKKK, mlklak, MLK7, AZK, MLT, MRK, HCCS-4, MAP3K20 and belongs to the MAPKKK family. It is a mitogen-activated protein kinase kinase kinase (MAP3K) that activates the stress-activated protein kinase/c-jun N-terminal kinase pathway and activates NF-kappaB. ZAK contributes to regulation of DNA damage checkpoints through a p38 gamma-independent pathway. This protein has 3 isoforms produced by alternative splicing with the MW of 91 kDa (ZAK alpha), 51 kDa (ZAK beta) and 35 kDa.