Product Information
81161-2-PBS targets ZAK in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag30599 Product name: Recombinant human ZAK protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 223-325 aa of BC001401 Sequence: ERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNKAEWRCEIEATLERLKKLERDLSFKEQELKERERRLKMWEQKLTEQ Predict reactive species |
| Full Name | sterile alpha motif and leucine zipper containing kinase AZK |
| Calculated Molecular Weight | 91 kDa |
| Observed Molecular Weight | 91kDa, 51 kDa |
| GenBank Accession Number | BC001401 |
| Gene Symbol | ZAK |
| Gene ID (NCBI) | 51776 |
| RRID | AB_3743369 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9NYL2 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
ZAK(sterile-alpha motif and leucine zipper containing kinase AZK) is also named as MLTK, MAPKKK, mlklak, MLK7, AZK, MLT, MRK, HCCS-4, MAP3K20 and belongs to the MAPKKK family. It is a mitogen-activated protein kinase kinase kinase (MAP3K) that activates the stress-activated protein kinase/c-jun N-terminal kinase pathway and activates NF-kappaB. ZAK contributes to regulation of DNA damage checkpoints through a p38 gamma-independent pathway. This protein has 3 isoforms produced by alternative splicing with the MW of 91 kDa (ZAK alpha), 51 kDa (ZAK beta) and 35 kDa.





