ZAN Polyclonal antibody

• 

  WB analysis using 33956-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33956-1-AP (ZAN antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse testis using 33956-1-AP

  IP result of anti-ZAN (IP:33956-1-AP, 4ug; Detection:33956-1-AP 1:800) with mouse testis tissue lysate 1520 ug.

ZAN Polyclonal Antibody for WB, IP, ELISA

Cat No. 33956-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, ELISA

Synonyms

Zonadhesin

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse testis tissue
• Positive IP detected in: mouse testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33956-1-AP targets ZAN in WB, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35843

  Product name: Recombinant human ZAN protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 18-200 aa of NM_003386

  Sequence: RKEKPPDQKLVVRSSRDNYVLTQCDFEDDAKPLCDWSQVSADDEDWVRASGPSPTGSTGAPGGYPNGEGSYLHMESNSFHRGGVARLLSPDLWEQGPLCVHFAHHMFGLSWGAQLRLLLLSGEEGRRPDVLWKHWNTQRPSWMLTTVTVPAGFTLPTRLMFEGTRGSTAYLDIALDALSIRRG

• Full Name: zonadhesin
• Calculated Molecular Weight: 305kDa
• Observed Molecular Weight: 230 kDa
• GenBank Accession Number: NM_003386
• Gene Symbol: ZAN
• Gene ID (NCBI): 7455
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9Y493
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ZAN (Zonadhesin) is a sperm-specific type-I transmembrane glycoprotein essential for species-restricted binding between spermatozoa and the egg's zona pellucida. First isolated from boar sperm, it is expressed solely in post-meiotic male germ cells (early spermatids) and localises to the apical segment of the sperm head.