ZBTB8OS Polyclonal antibody, PBS Only

• 

  WB analysis using 28608-1-AP (same clone as 28608-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28608-1-AP (ZBTB8OS antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28608-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 28608-1-AP (same clone as 28608-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 28608-1-AP (ZBTB8OS antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28608-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 28608-1-AP (same clone as 28608-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 28608-1-AP (ZBTB8OS antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28608-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 28608-1-AP (same clone as 28608-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 28608-1-AP (ZBTB8OS antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28608-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 28608-1-AP (same clone as 28608-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 28608-1-AP (ZBTB8OS antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28608-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 28608-1-AP (same clone as 28608-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 28608-1-AP (ZBTB8OS antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28608-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 28608-1-AP (same clone as 28608-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 28608-1-AP (ZBTB8OS antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28608-1-PBS in a different storage buffer formulation.

ZBTB8OS Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 28608-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

28608-1-PBS targets ZBTB8OS in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29853

  Product name: Recombinant human ZBTB8OS protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 2-136 aa of BC058843

  Sequence: AQEEEDVRDYNLTEEQKAIKAKYPPVNRKYEYLDHTADVQLHAWGDTLEEAFEQCAMAMFGYMTDTGTVEPLQTVEVETQGDDLQSLLFHFLDEWLYKFSADEFFIPRVGRRIFIVQAPSGNRSQSNNIFSNAGL

• Full Name: zinc finger and BTB domain containing 8 opposite strand
• Observed Molecular Weight: 19 kDa
• GenBank Accession Number: BC058843
• Gene Symbol: ZBTB8OS
• Gene ID (NCBI): 339487
• RRID: AB_2881180
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IWT0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.