ZBTB8OS Polyclonal antibody

• 

  WB analysis using 28608-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28608-1-AP (ZBTB8OS antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse kidney using 28608-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 28608-1-AP (ZBTB8OS antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 28608-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 28608-1-AP (ZBTB8OS antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse spleen using 28608-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 28608-1-AP (ZBTB8OS antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse spleen using 28608-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 28608-1-AP (ZBTB8OS antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 28608-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 28608-1-AP (ZBTB8OS antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 28608-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 28608-1-AP (ZBTB8OS antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

ZBTB8OS Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28608-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat and More (1)

Applications

WB, IHC, ELISA

Synonyms

ARCH, ARCH2, Protein archease, Protein ZBTB8OS, ZBTB8OS

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, rat kidney tissue
• Positive IHC detected in: mouse kidney tissue, mouse spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

28608-1-AP targets ZBTB8OS in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29853

  Product name: Recombinant human ZBTB8OS protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 2-136 aa of BC058843

  Sequence: AQEEEDVRDYNLTEEQKAIKAKYPPVNRKYEYLDHTADVQLHAWGDTLEEAFEQCAMAMFGYMTDTGTVEPLQTVEVETQGDDLQSLLFHFLDEWLYKFSADEFFIPRVGRRIFIVQAPSGNRSQSNNIFSNAGL

• Full Name: zinc finger and BTB domain containing 8 opposite strand
• Observed Molecular Weight: 19 kDa
• GenBank Accession Number: BC058843
• Gene Symbol: ZBTB8OS
• Gene ID (NCBI): 339487
• RRID: AB_2881180
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IWT0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Commun Biol; DDX1 is required for non-spliceosomal splicing of tRNAs but not of XBP1 mRNA; Authors - Teruhiko Suzuki