ZC3H12D Monoclonal antibody, PBS Only

• 

  WB analysis using 68847-1-Ig (same clone as 68847-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68847-1-Ig (ZC3H12D antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68847-1-PBS in a different storage buffer formulation.

ZC3H12D Monoclonal Antibody for ELISA, WB

Cat No. 68847-1-PBS

Clone No.1E2A2

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

ELISA, WB

Synonyms

MCP-induced protein 4, MCP induced protein 4, FLJ46041, EC:3.1.-.-, C6orf95

---

Product Information

68847-1-PBS targets ZC3H12D in ELISA, WB applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21770

  Product name: Recombinant human ZC3H12D protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-90 aa of BC157832

  Sequence: MEHPSKMEFFQKLGYDREDVLRVLGKLGEGALVNDVLQELIRTGSRPGALEHPAAPRLVPRGSCGVPDSAQRGPGTALEEDFRTLASSLR

• Full Name: zinc finger CCCH-type containing 12D
• Calculated Molecular Weight: 527 aa, 58 kDa
• GenBank Accession Number: BC157832
• Gene Symbol: ZC3H12D
• Gene ID (NCBI): 340152
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: A2A288
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ZC3H12D, also named as MCP induced protein 4, is a 527 amino acid protein, which contains one C3H1-type zinc finger and belongs to the ZC3H12 family. ZC3H12D exists as three isoforms and localizes in the cytoplasm. ZC3H12D may regulate cell growth likely by suppressing RB1 phosphorylation and serves as a tumor suppressor in certain leukemia cells. ZC3H12D is expressed in normal human lymphocytes but defective in some leukemia/lymphoma cell lines.