Product Information
68847-1-PBS targets ZC3H12D in ELISA, WB applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21770 Product name: Recombinant human ZC3H12D protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-90 aa of BC157832 Sequence: MEHPSKMEFFQKLGYDREDVLRVLGKLGEGALVNDVLQELIRTGSRPGALEHPAAPRLVPRGSCGVPDSAQRGPGTALEEDFRTLASSLR Predict reactive species |
| Full Name | zinc finger CCCH-type containing 12D |
| Calculated Molecular Weight | 527 aa, 58 kDa |
| GenBank Accession Number | BC157832 |
| Gene Symbol | ZC3H12D |
| Gene ID (NCBI) | 340152 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | A2A288 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |

