ZC3H12D Recombinant monoclonal antibody, PBS Only (Detector)

• 

  WB analysis of Raji using 83507-2-RR (same clone as 83507-2-PBS)

  Raji cells were subjected to SDS PAGE followed by western blot with 83507-2-RR (ZC3H12D antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83507-2-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 83507-2-RR (same clone as 83507-2-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug ZC3H12D Recombinant antibody (83507-2-RR, Clone:240464C5) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 83507-2-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP00495-1

  Cytometric bead array standard curve of MP00495-1, ZC3H12D Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 83507-1-PBS. Detection antibody: 83507-2-PBS. Standard: Ag21770. Range: 0.156-20 ng/mL.

• 

  Affinity and Kinetic Characterization of 83507-2-RR

  Biolayer interferometry (BLl) kinetic assays of 83507-2-RR against Human ZC3H12D were performed. The affinity constant is 0.343 nM.

ZC3H12D Uni-rAb^® Recombinant Antibody for WB, FC (Intra), Cytometric bead array, Indirect ELISA

Cat No. 83507-2-PBS

Clone No.240464C5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), Cytometric bead array, Indirect ELISA

Synonyms

MCP-induced protein 4, MCP induced protein 4, FLJ46041, EC:3.1.-.-, C6orf95

---

Product Information

83507-2-PBS targets ZC3H12D as part of a matched antibody pair:

MP00495-1: 83507-1-PBS capture and 83507-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag21770

  Product name: Recombinant human ZC3H12D protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-90 aa of BC157832

  Sequence: MEHPSKMEFFQKLGYDREDVLRVLGKLGEGALVNDVLQELIRTGSRPGALEHPAAPRLVPRGSCGVPDSAQRGPGTALEEDFRTLASSLR

• Full Name: zinc finger CCCH-type containing 12D
• Calculated Molecular Weight: 527 aa, 58 kDa
• GenBank Accession Number: BC157832
• Gene Symbol: ZC3H12D
• Gene ID (NCBI): 340152
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: A2A288
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ZC3H12D, also named as MCP induced protein 4, is a 527 amino acid protein, which contains one C3H1-type zinc finger and belongs to the ZC3H12 family. ZC3H12D exists as three isoforms and localizes in the cytoplasm. ZC3H12D may regulate cell growth likely by suppressing RB1 phosphorylation and serves as a tumor suppressor in certain leukemia cells. ZC3H12D is expressed in normal human lymphocytes but defective in some leukemia/lymphoma cell lines.