ZCCHC3 Polyclonal antibody

• 

  WB analysis using 29399-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29399-1-AP (ZCCHC3 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

ZCCHC3 Polyclonal Antibody for WB, ELISA

Cat No. 29399-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

Human and More (1)

Applications

WB, IHC, ELISA

Synonyms

C20orf99, ZCCHC3

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HepG2 cells, K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below
• IHC: See 2 publications below

Product Information

29399-1-AP targets ZCCHC3 in WB, IHC, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30047

  Product name: Recombinant human ZCCHC3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-171 aa of NM_033089

  Sequence: MATGGGAEEERKRGRPQLLPPARPAARGEEADGGREKMGWAQVVKNLAEKKGEFREPRPPRREEESGGGGGSAGLGGPAGLAAPDLGDFPPAGRGDPKGRRRDPAGEAVDPRKKKGAAEAGRRKKAEAAAAAMATPARPGEAEDAAERPLQDEPAAAAGPGKGRFLVRICF

• Full Name: zinc finger, CCHC domain containing 3
• Calculated Molecular Weight: 44 kDa
• Observed Molecular Weight: 43-45 kDa
• GenBank Accession Number: NM_033089
• Gene Symbol: ZCCHC3
• Gene ID (NCBI): 85364
• RRID: AB_2918294
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NUD5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Pathol Int; Combined use of immunoreactivities of Efp and ZCCHC3 for predicting prognosis of patients with triple-negative breast cancer; Authors - Akihiro Fujimoto
human	WB	Biochem Biophys Res Commun; ZCCHC3 and Efp coordinately contribute to the pathophysiology of triple-negative breast cancer by modulating NCAPH; Authors - Akihiro Fujimoto ; KD Validated
		Cell Genom; Repeats mimic pathogen-associated patterns across a vast evolutionary landscape; Authors - Petr Šulc
human	IHC	Pathol Int; Immunoreactivities of ZCCHC3 and Efp in the High-Grade Serous and Clear Cell Ovarian Carcinomas Are Worse Prognostic Factors.; Authors - Erina Iwabuchi