ZCCHC6 Polyclonal antibody, PBS Only

• 

  WB analysis of PC-3 using 25196-1-AP (same clone as 25196-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 25196-1-AP (ZCCHC6 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25196-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 25196-1-AP (same clone as 25196-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25196-1-AP (ZCCHC6 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25196-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 25196-1-AP (same clone as 25196-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 25196-1-AP (ZCCHC6 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25196-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 25196-1-AP (same clone as 25196-1-PBS)

  IP result of anti-ZCCHC6 (IP:25196-1-AP, 4ug; Detection:25196-1-AP 1:1000) with HeLa cells lysate 1800ug. This data was developed using the same antibody clone with 25196-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ZCCHC6 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 25196-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

---

Product Information

25196-1-PBS targets ZCCHC6 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18240

  Product name: Recombinant human ZCCHC6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-251 aa of BC032456

  Sequence: MGDTAKPYFVKRTKDRGTMDDDDFRRGHPQQDYLIIDDHAKGHGSKMEKGLQKKKITPGNYGNTPRKGPCAVSSNPYAFKNPIYSQPAWMNDSHKDQSKRWLSDEHTGNSDNWREFKPGPRIPVINRQRKDSFQENEDGYRWQDTRGCRTVRRLFHKDLTSLETTSEMEAGSPENKKQRSRPRKPRKTRNEENEQDGDLEGPVIDESVLSTKELLGLQQAEERLKRDCIDRLKRRPRNYPTAKYTCRLCDV

• Full Name: zinc finger, CCHC domain containing 6
• Calculated Molecular Weight: 1495 aa, 171 kDa
• Observed Molecular Weight: 171 kDa
• GenBank Accession Number: BC032456
• Gene Symbol: ZCCHC6
• Gene ID (NCBI): 79670
• RRID: AB_2879953
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5VYS8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ZCCHC6 also named as KIAA1711 ,HS2 or TUT7 is a 1495 amino acid protein, which contains threes CCHC-type zinc fingers and two PAP-associated domains. A member of the DNA polymerase type-B-like family, ZCCHC6 as a uridylyltransferase that mediates RNA uridylation.