ZCCHC6 Polyclonal antibody

• 

  WB analysis of PC-3 using 25196-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 25196-1-AP (ZCCHC6 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 25196-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25196-1-AP (ZCCHC6 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 25196-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 25196-1-AP (ZCCHC6 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 25196-1-AP

  IP result of anti-ZCCHC6 (IP:25196-1-AP, 4ug; Detection:25196-1-AP 1:1000) with HeLa cells lysate 1800ug.

• Featured Product
• KD/KO Validated

ZCCHC6 Polyclonal Antibody for WB, IP, ELISA

Cat No. 25196-1-AP

Publications(15)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, IP, CoIP, ELISA

Synonyms

HS2, KIAA1711, PAPD6, Terminal uridylyltransferase 7, TUT7, TUTase 7, ZCCHC6

---

Tested Applications

• Positive WB detected in: PC-3 cells, HEK-293T cells, mouse brain tissue
• Positive IP detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 4 publications below
• WB: See 13 publications below
• IF: See 1 publications below
• IP: See 1 publications below
• CoIP: See 1 publications below

Product Information

25196-1-AP targets ZCCHC6 in WB, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18240

  Product name: Recombinant human ZCCHC6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-251 aa of BC032456

  Sequence: MGDTAKPYFVKRTKDRGTMDDDDFRRGHPQQDYLIIDDHAKGHGSKMEKGLQKKKITPGNYGNTPRKGPCAVSSNPYAFKNPIYSQPAWMNDSHKDQSKRWLSDEHTGNSDNWREFKPGPRIPVINRQRKDSFQENEDGYRWQDTRGCRTVRRLFHKDLTSLETTSEMEAGSPENKKQRSRPRKPRKTRNEENEQDGDLEGPVIDESVLSTKELLGLQQAEERLKRDCIDRLKRRPRNYPTAKYTCRLCDV

• Full Name: zinc finger, CCHC domain containing 6
• Calculated Molecular Weight: 1495 aa, 171 kDa
• Observed Molecular Weight: 171 kDa
• GenBank Accession Number: BC032456
• Gene Symbol: ZCCHC6
• Gene ID (NCBI): 79670
• RRID: AB_2879953
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5VYS8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ZCCHC6 also named as KIAA1711 ,HS2 or TUT7 is a 1495 amino acid protein, which contains threes CCHC-type zinc fingers and two PAP-associated domains. A member of the DNA polymerase type-B-like family, ZCCHC6 as a uridylyltransferase that mediates RNA uridylation.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Mol Cell; Spatiotemporal Proteomic Analysis of Stress Granule Disassembly Using APEX Reveals Regulation by SUMOylation and Links to ALS Pathogenesis.; Authors - Hagai Marmor-Kollet
human	WB	Mol Cell; 3' Uridylation Confers miRNAs with Non-canonical Target Repertoires.; Authors - Acong Yang ; KO Validated
human	WB	Mol Cell; A Mechanism for microRNA Arm Switching Regulated by Uridylation.; Authors - Haedong Kim ; KD Validated
human	WB,IP	Nat Commun; TENT2, TUT4, and TUT7 selectively regulate miRNA sequence and abundance; Authors - Acong Yang
human	WB,CoIP	Nat Commun; AGO-bound mature miRNAs are oligouridylated by TUTs and subsequently degraded by DIS3L2.; Authors - Acong Yang
human	WB	Elife; The molecular basis of coupling between poly(A)-tail length and translational efficiency.; Authors - Kehui Xiang