ZCCHC6 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ZCCHC6 Polyclonal antibody (25196-1-AP)

• Featured Product
• KD/KO Validated

ZCCHC6 Polyclonal Antibody for WB, IP, ELISA

Cat No. 25196-1-AP Copied!

Publications (16)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, IP, CoIP, ELISA

Synonyms

EC:2.7.7.52, HS2, KIAA1711, PAPD6, Terminal uridylyltransferase 7

• 

  WB analysis using 25196-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25196-1-AP (ZCCHC6 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 25196-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 25196-1-AP (ZCCHC6 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 25196-1-AP

  IP result of anti-ZCCHC6 (IP:25196-1-AP, 4ug; Detection:25196-1-AP 1:1000) with HeLa cells lysate 1800ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ZCCHC6 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293T cells, mouse brain tissue, HeLa cells, MCF-7 cells, PC-3 cells
• Positive IP detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25196-1-AP targets ZCCHC6 in WB, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18240

  Product name: Recombinant human ZCCHC6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-251 aa of BC032456

  Sequence: MGDTAKPYFVKRTKDRGTMDDDDFRRGHPQQDYLIIDDHAKGHGSKMEKGLQKKKITPGNYGNTPRKGPCAVSSNPYAFKNPIYSQPAWMNDSHKDQSKRWLSDEHTGNSDNWREFKPGPRIPVINRQRKDSFQENEDGYRWQDTRGCRTVRRLFHKDLTSLETTSEMEAGSPENKKQRSRPRKPRKTRNEENEQDGDLEGPVIDESVLSTKELLGLQQAEERLKRDCIDRLKRRPRNYPTAKYTCRLCDV

• Full Name: zinc finger, CCHC domain containing 6
• Calculated Molecular Weight: 1495 aa, 171 kDa
• Observed Molecular Weight: 171 kDa
• GenBank Accession Number: BC032456
• Gene Symbol: ZCCHC6
• Gene ID (NCBI): 79670
• RRID: AB_2879953
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5VYS8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ZCCHC6 also named as KIAA1711 ,HS2 or TUT7 is a 1495 amino acid protein, which contains threes CCHC-type zinc fingers and two PAP-associated domains. A member of the DNA polymerase type-B-like family, ZCCHC6 as a uridylyltransferase that mediates RNA uridylation.

Publications

What published studies show

The anti-TUT7 antibody (Cat# 25196-1-AP) has 16 total citations across journals including Nature Communications, Molecular Cell, Cell Reports, RNA, iScience, Scientific Reports, Cell Biosciences, Viruses, eLife, and PLoS ONE. Research fields span miRNA uridylation and turnover, post-transcriptional gene regulation, stress granule dynamics, ALS pathogenesis, innate immunity, viral RNA metabolism, oocyte mRNA homeostasis, and neural differentiation. Applications include WB, IP, CoIP, and IF in human and mouse systems.

Automatically generated from the 16 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IP	Nat Commun; TENT2, TUT4, and TUT7 selectively regulate miRNA sequence and abundance; Authors - Acong Yang
human	WB,CoIP	Nat Commun; AGO-bound mature miRNAs are oligouridylated by TUTs and subsequently degraded by DIS3L2.; Authors - Acong Yang
human	IF	Mol Cell; Spatiotemporal Proteomic Analysis of Stress Granule Disassembly Using APEX Reveals Regulation by SUMOylation and Links to ALS Pathogenesis.; Authors - Hagai Marmor-Kollet
human	WB	Mol Cell; A Mechanism for microRNA Arm Switching Regulated by Uridylation.; Authors - Haedong Kim ; KD Validated
human	WB	Mol Cell; 3' Uridylation Confers miRNAs with Non-canonical Target Repertoires.; Authors - Acong Yang ; KO Validated
human	WB	Cell Rep; The long isoform of ZAP coordinates multiple enzymes to mediate complete decay of target transcripts.; Authors - Clément R. Bouton