ZDHHC15 Polyclonal antibody

• 

  WB analysis using 21627-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21627-1-AP (ZDHHC15 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SMMC-7721 using 21627-1-AP

  SMMC-7721 cells were subjected to SDS PAGE followed by western blot with 21627-1-AP (ZDHHC15 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SMMC-7721 using 21627-1-AP

  SMMC-7721 cells were subjected to SDS PAGE followed by western blot with 21627-1-AP (ZDHHC15 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SMMC-7721 using 21627-1-AP

  SMMC-7721 cells were subjected to SDS PAGE followed by western blot with 21627-1-AP (ZDHHC15 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

ZDHHC15 Polyclonal Antibody for WB, ELISA

Cat No. 21627-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, ELISA

Synonyms

MRX91, EC:2.3.1.225, EC:2.3.1.-, DHHC-15, DHHC 15

---

Tested Applications

• Positive WB detected in: HEK-293 cells, SMMC-7721 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IP: See 1 publications below

Product Information

21627-1-AP targets ZDHHC15 in WB, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16152

  Product name: Recombinant human ZDHHC15 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 238-337 aa of BC103982

  Sequence: VSRNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDKKKFWLIPIGSSPGDGHSFPMRSMNESQNPLLANEETWEDNEDDNQDYPEGSSSLAVETET

• Full Name: zinc finger, DHHC-type containing 15
• Calculated Molecular Weight: 337 aa, 39 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC103982
• Gene Symbol: ZDHHC15
• Gene ID (NCBI): 158866
• RRID: AB_2878892
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96MV8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	IP	Mol Cell Endocrinol; ZDHHC17 participates in the pathogenesis of polycystic ovary syndrome by affecting androgen conversion to estrogen in granulosa cells; Authors - Shanmeizi Zhao