ZDHHC15 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ZDHHC15 Polyclonal antibody (21627-1-AP)

ZDHHC15 Polyclonal Antibody for WB, ELISA

Cat No. 21627-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, ELISA

Synonyms

MRX91, EC:2.3.1.225, EC:2.3.1.-, DHHC-15, DHHC 15

• 

  WB analysis using 21627-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21627-1-AP (ZDHHC15 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of SMMC-7721 using 21627-1-AP

  SMMC-7721 cells were subjected to SDS PAGE followed by western blot with 21627-1-AP (ZDHHC15 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of SMMC-7721 using 21627-1-AP

  SMMC-7721 cells were subjected to SDS PAGE followed by western blot with 21627-1-AP (ZDHHC15 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of SMMC-7721 using 21627-1-AP

  SMMC-7721 cells were subjected to SDS PAGE followed by western blot with 21627-1-AP (ZDHHC15 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ZDHHC15 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, SMMC-7721 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21627-1-AP targets ZDHHC15 in WB, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16152

  Product name: Recombinant human ZDHHC15 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 238-337 aa of BC103982

  Sequence: VSRNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDKKKFWLIPIGSSPGDGHSFPMRSMNESQNPLLANEETWEDNEDDNQDYPEGSSSLAVETET

• Full Name: zinc finger, DHHC-type containing 15
• Calculated Molecular Weight: 337 aa, 39 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC103982
• Gene Symbol: ZDHHC15
• Gene ID (NCBI): 158866
• RRID: AB_2878892
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96MV8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The ZDHHC15 Polyclonal antibody (Cat# 21627-1-AP) has a total of 2 citations. These appear in Cancer Science (2026), where it was used to study S-palmitoylation of PPARγ in breast cancer, and Molecular and Cellular Endocrinology (2023), where it was applied in IP to investigate ZDHHC17's role in polycystic ovary syndrome. The associated research fields are cancer biology (breast malignancy) and endocrinology (ovarian hormone metabolism).

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Cancer Sci; Adipocyte-Derived Palmitic Acid Promotes Breast Cancer Malignancy via ZDHHC15-Mediated S-Palmitoylation of PPARγ.; Authors - Geon Ho Moon
	IP	Mol Cell Endocrinol; ZDHHC17 participates in the pathogenesis of polycystic ovary syndrome by affecting androgen conversion to estrogen in granulosa cells; Authors - Shanmeizi Zhao