Tested Applications
| Positive WB detected in | PC-3 cells, MCF-7 cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25985-1-AP targets ZDHHC7 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag23185 Product name: Recombinant human ZDHHC7 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 279-345 aa of BC018772 Sequence: IHSICNDETEIERLKSEKPTWERRLRWEGMKSVFGGPPSLLWMNPFVGFRFRRLPTRPRKGGPEFSV Predict reactive species | 
                                    
| Full Name | zinc finger, DHHC-type containing 7 | 
| Calculated Molecular Weight | 345 aa, 39 kDa | 
| Observed Molecular Weight | 45-49 kDa | 
| GenBank Accession Number | BC018772 | 
| Gene Symbol | ZDHHC7 | 
| Gene ID (NCBI) | 55625 | 
| RRID | AB_2880320 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q9NXF8 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for ZDHHC7 antibody 25985-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 







