Tested Applications
| Positive WB detected in | COLO 320 cells, MCF-7 cells, PC-3 cells, Jurkat cells, MDA-MB-453s cells, mouse colon tissue, HeLa cells |
| Positive IP detected in | COLO 320 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:20000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 23 publications below |
| WB | See 251 publications below |
| IHC | See 35 publications below |
| IF | See 23 publications below |
| IP | See 6 publications below |
| CoIP | See 4 publications below |
| ChIP | See 13 publications below |
Product Information
21544-1-AP targets ZEB1 in WB, IHC, IF, IP, CoIP, chIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16204 Product name: Recombinant human ZEB1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 391-740 aa of BC112392 Sequence: MVQAVVLPTVGLVSPISINLSDIQNVLKVAVDGNVIRQVLENNQANLASKEQETINASPIQQGGHSVISAISLPLVDQDGTTKIIINYSLEQPSQLQVVPQNLKKENPVATNSCKSEKLPEDLTVKSEKDKSFEGGVNDSTCLLCDDCPGDINALPELKHYDLKQPTQPPPLPAAEAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGSTTNGSRSSTPSPSPLNLSSSRNTQGYLYTAEGAQEEPQVEPLDLSL Predict reactive species |
| Full Name | zinc finger E-box binding homeobox 1 |
| Calculated Molecular Weight | 1125 aa, 124 kDa |
| Observed Molecular Weight | 190-210 kDa |
| GenBank Accession Number | BC112392 |
| Gene Symbol | ZEB1 |
| Gene ID (NCBI) | 6935 |
| RRID | AB_10734325 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P37275 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ZEB1(zinc-finger-enhancer binding protein 1), which is a member of the Zinc finger-Homeobox (ZFH) family of repressors, acts as a transcriptional repressor that inhibits interleukin-2 (IL-2) gene expression. Depending on the quantity of cDNA and on the cell type, ZEB1 can enhance or repress the promoter activity of the ATP1A1 gene. Represses E-cadherin promoter and induces an epithelial-mesenchymal transition (EMT) by recruiting SMARCA4/BRG1. Represses BCL6 transcription in the presence of the corepressor CTBP1. Positively regulates neuronal differentiation. The calculated molecular weight of ZEB1 is 124 kDa, but the post-phosphorylation of protein is about 190-210 kDa. This is a rabbit polyclonal antibody raised against part of the full length of ZEB1 of human.
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for ZEB1 antibody 21544-1-AP | Download protocol |
| WB protocol for ZEB1 antibody 21544-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) The Conserved LncRNA DIO3OS Restricts Hepatocellular Carcinoma Stemness by Interfering with NONO-Mediated Nuclear Export of ZEB1 mRNA | ||
Adv Sci (Weinh) PHOSPHO1 Suppresses Ferroptosis in Retinal Pigment Epithelial Cells by Reducing the Levels of Phosphatidylethanolamine Molecular Species | ||
Nat Commun A non-canonical pathway regulates ER stress signaling and blocks ER stress-induced apoptosis and heart failure. | ||
Nat Commun Cooperative interaction between ERα and the EMT-inducer ZEB1 reprograms breast cancer cells for bone metastasis. | ||
Nat Commun Long non-coding RNA NR2F1-AS1 induces breast cancer lung metastatic dormancy by regulating NR2F1 and ΔNp63. | ||
J Exp Med Squamous cell carcinoma subverts adjacent histologically normal epithelium to promote lateral invasion. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Yussuf (Verified Customer) (12-25-2025) | Performed really well in an IP.
|
FH Kathryn (Verified Customer) (10-14-2021) | Antibody worked really well first time and produced clear Zeb1 bands at the MW expected, with barely any non specific binding.
|
FH K (Verified Customer) (12-20-2020) | I used tis Ab for western blotting at 1:2000 dilution and got good results.
|











