ZFR Polyclonal antibody

• 

  WB analysis using 23174-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 23174-1-AP (ZFR antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human heart using 23174-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 23174-1-AP (ZFR Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human small intestine using 23174-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 23174-1-AP (ZFR Antibody) at dilution of 1:50 (under 10x lens).

ZFR Polyclonal Antibody for WB, IHC, ELISA

Cat No. 23174-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

Zinc finger RNA-binding protein, ZFR1, M-phase phosphoprotein homolog, M phase phosphoprotein homolog, hZFR

---

Tested Applications

• Positive WB detected in: A549 cells, HEK-293 cells, HepG2 cells
• Positive IHC detected in: human small intestine tissue, human heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

23174-1-AP targets ZFR in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19559

  Product name: Recombinant human ZFR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-346 aa of BC137085

  Sequence: MIPICPVVSFTYVPSRLGEDAKMATGNYFGFTHSGAAAAAAAAQYSQQPASGVAYSHPTTVASYTVHQAPVAAHTVTAAYAPAAATVAVARPAPVAVAAAATAAAYGGYPTAHTATDYGYTQRQQEAPPPPPPATTQNYQDSYSYVRSTAPAVAYDSKQYYQQPTATAAAVAAAAQPQPSVAETYYQTAPKAGYSQGATQYTQAQQTRQVTAIKPATPSPATTTFSIYPVSSTVQPVAAAATVVPSYTQSATYSTTAVTYSGTSYSGYEAAVYSAASSYYQQQQQQQKQAAAAAAAAAATAAWTGTTFTKKAPFQNKQLKPKQPPKPPQIHYCDVCKISCAGPQTY

• Full Name: zinc finger RNA binding protein
• Calculated Molecular Weight: 1074 aa, 117 kDa
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: BC137085
• Gene Symbol: ZFR
• Gene ID (NCBI): 51663
• RRID: AB_3085708
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q96KR1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.