Tested Applications
Positive WB detected in | HL-60 cells, HeLa cells, K-562 cells, PC-12 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:3000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
27655-1-AP targets ZFX in WB, ELISA applications and shows reactivity with Human, rat samples.
Tested Reactivity | Human, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag26576 Product name: Recombinant human ZFX protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 711-805 aa of NM_001178084 Sequence: MSVHTKDLPFRCKRCRKGFRQQSELKKHMKTHSGRKVYQCEYCEYSTTDASGFKRHVISIHTKDYPHRCEYCKKGFRRPSEKNQHIMRHHKEVGLP Predict reactive species |
Full Name | zinc finger protein, X-linked |
Calculated Molecular Weight | 91 kDa |
Observed Molecular Weight | ~130 kDa |
GenBank Accession Number | NM_001178084 |
Gene Symbol | ZFX |
Gene ID (NCBI) | 7543 |
RRID | AB_3085980 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P17010 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ZFX (Zinc finger protein, X-linked), a key factor that controls the self-renewal of ESCs, belongs to the ZFY family whose members (ZFX, ZFY, ZFA) have similar molecular structures. Mammalian ZFX contains an acidic transcriptional activation domain, a nuclear localization signal (NLS) sequence, and a DNA binding domain consisting of 13 C2H2 zinc fingers. Knocking out ZFX has been shown to impair the self-renewal capacity of mouse ESC and tissue-specific adult stem cell such as hematopoietic stem cells (HSCs) without affecting their differentiation, and ZFX overexpression has been shown to promote ESC self-renewal by impeding differentiation. It's reported that t the 130 kDa band was N-glycosylated, and such a posttranslational modification (PTM) may control the nuclear import of ZFX, 91 kDa may be the non-N-glycosylated subtype which was lowly expressed. (PMID: 23322077, PMID:24228108)
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ZFX antibody 27655-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |