ZFX Polyclonal antibody

ZFX Polyclonal Antibody for WB, ELISA
Cat No. 27655-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, rat

Applications

WB, ELISA

ZFX, zinc finger protein, X linked

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHL-60 cells, HeLa cells, K-562 cells, PC-12 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27655-1-AP targets ZFX in WB, ELISA applications and shows reactivity with Human, rat samples.

Tested Reactivity Human, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag26576

Product name: Recombinant human ZFX protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 711-805 aa of NM_001178084

Sequence: MSVHTKDLPFRCKRCRKGFRQQSELKKHMKTHSGRKVYQCEYCEYSTTDASGFKRHVISIHTKDYPHRCEYCKKGFRRPSEKNQHIMRHHKEVGLP

Predict reactive species
Full Name zinc finger protein, X-linked
Calculated Molecular Weight 91 kDa
Observed Molecular Weight~130 kDa
GenBank Accession NumberNM_001178084
Gene Symbol ZFX
Gene ID (NCBI) 7543
RRIDAB_3085980
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP17010
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ZFX (Zinc finger protein, X-linked), a key factor that controls the self-renewal of ESCs, belongs to the ZFY family whose members (ZFX, ZFY, ZFA) have similar molecular structures. Mammalian ZFX contains an acidic transcriptional activation domain, a nuclear localization signal (NLS) sequence, and a DNA binding domain consisting of 13 C2H2 zinc fingers. Knocking out ZFX has been shown to impair the self-renewal capacity of mouse ESC and tissue-specific adult stem cell such as hematopoietic stem cells (HSCs) without affecting their differentiation, and ZFX overexpression has been shown to promote ESC self-renewal by impeding differentiation. It's reported that t the 130 kDa band was N-glycosylated, and such a posttranslational modification (PTM) may control the nuclear import of ZFX, 91 kDa may be the non-N-glycosylated subtype which was lowly expressed. (PMID: 23322077, PMID:24228108)

Protocols

Product Specific Protocols
WB protocol for ZFX antibody 27655-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...