SARA Polyclonal antibody

• 

  WB analysis using 22033-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22033-1-AP (SARA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 22033-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 22033-1-AP (SARA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 22033-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 22033-1-AP (SARA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 22033-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 22033-1-AP (SARA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 22033-1-AP

  IP result of anti-SARA (IP:22033-1-AP, 5ug; Detection:22033-1-AP 1:1000) with mouse brain tissue lysate 5000ug.

• 

  IHC staining of human kidney using 22033-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 22033-1-AP (SARA antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human kidney using 22033-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 22033-1-AP (SARA antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of mouse brain using 22033-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using SARA antibody (22033-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of mouse kidney using 22033-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse kidney tissue using SARA antibody (22033-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

SARA Polyclonal Antibody for WB, IHC, IF-P, IP, ELISA

Cat No. 22033-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IP, ELISA

Synonyms

hSARA, Madh interacting protein, MADHIP, Novel serine protease, NSP, Receptor activation anchor, SARA, SMADIP, ZFYVE9

---

Tested Applications

• Positive WB detected in: HEK-293 cells, mouse brain tissue, MCF-7 cells, human brain tissue, HeLa cells
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse brain tissue, mouse kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 4 publications below
• IF: See 2 publications below

Product Information

22033-1-AP targets SARA in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16929

  Product name: Recombinant human ZFYVE9 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1075-1425 aa of BC032680

  Sequence: MLRLGAEYRLYPCPLFSVRFRKPLFGETGHTIMNLLADFRNYQYTLPVVQGLVVDMEVRKTSIKIPSNRYNEMMKAMNKSNEHVLAGGACFNEKADSHLVCVQNDDGNYQTQAISIHNQPRKVTGASFFVFSGALKSSSGYLAKSSIVEDGVMVQITAENMDSLRQALREMKDFTITCGKADAEEPQEHIHIQWVDDDKNVSKGVVSPIDGKSMETITNVKIFHGSEYKANGKVIRWTEVFFLENDDQHNCLSDPADHSRLTEHVAKAFCLALCPHLKLLKEDGMTKLGLRVTLDSDQVGYQAGSNGQPLPSQYMNDLDSALVPVIHGGACQLSEGPVVMELIFYILENIV

• Full Name: zinc finger, FYVE domain containing 9
• Calculated Molecular Weight: 1425 aa, 156 kDa
• Observed Molecular Weight: 156 kDa
• GenBank Accession Number: BC032680
• Gene Symbol: SARA
• Gene ID (NCBI): 9372
• RRID: AB_11182938
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95405
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ZFYVE9, also known as SARA (Smad anchor for receptor activation), is a double zinc finger (FYVE domain) protein that interacts directly with SMAD2 and SMAD3, and is involved in Alzheimer's disease. SARA functions to recruit SMAD2/SMAD3 to intracellular membranes and to the TGF-beta receptor. SARA plays a significant role in TGF-mediated signaling by regulating the subcellular location of SMAD2 and SMAD3 and modulating the transcriptional activity of the SMAD3/SMAD4 complex. SARA is possibly associated with TGF-beta receptor internalization.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Structure; Structural Basis for Specific Interaction of TGFβ Signaling Regulators SARA/Endofin with HD-PTP.; Authors - Deepankar Gahloth ; KD Validated
mouse	WB,IF	J Bone Miner Res; Dysfunction of Caveolae-mediated Endocytic TβRI Degradation Results in Hypersensitivity of TGF-β/Smad Signaling in Osteogenesis Imperfecta; Authors - Changgui Shi
human	WB,IF	Sci Adv; Neuropilin 1 is an entry receptor for KSHV infection of mesenchymal stem cell through TGFBR1/2-mediated macropinocytosis; Authors - Zheng-Zhou Lu ; KO Validated
mouse	WB	Autophagy; Autophagic degradation of SQSTM1 enables fibroblast activation to accelerate wound healing; Authors - Yujiao Xu