ZIK1 Polyclonal antibody, PBS Only

• 

  WB analysis of Jurkat using 21934-1-AP (same clone as 21934-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 21934-1-AP (ZIK1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21934-1-PBS in a different storage buffer formulation.

• 

  IP experiment of Jurkat using 21934-1-AP (same clone as 21934-1-PBS)

  IP result of anti-ZIK1 (IP:21934-1-AP, 4ug; Detection:21934-1-AP 1:300) with Jurkat cells lysate 2800ug. This data was developed using the same antibody clone with 21934-1-PBS in a different storage buffer formulation.

ZIK1 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 21934-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, Indirect ELISA

Synonyms

---

Product Information

21934-1-PBS targets ZIK1 in WB, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16568

  Product name: Recombinant human ZIK1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 62-243 aa of BC103958

  Sequence: LVASLGCGHGTEDEETPSDQNVSVGVSQSKAGSSTQKTQSCEMCVPVLKDILHLADLPGQKPYLVGECTNHHQHQKHHSAKKSLKRDMDRASYVKCCLFCMSLKPFRKWEVGKDLPAMLRLLRSLVFPGGKKPGTITECGEDIRSQKSHYKSGECGKASRHKHTPVYHPRVYTGKKLYECSK

• Full Name: zinc finger protein interacting with K protein 1 homolog (mouse)
• Calculated Molecular Weight: 487 aa, 55 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC103958
• Gene Symbol: ZIK1
• Gene ID (NCBI): 284307
• RRID: AB_2878948
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q3SY52
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.