ZIM3 Polyclonal antibody, PBS Only

• 

  WB analysis of COLO 320 using 25200-1-AP (same clone as 25200-1-PBS)

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 25200-1-AP (ZIM3 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25200-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 25200-1-AP (same clone as 25200-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 25200-1-AP (ZIM3 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25200-1-PBS in a different storage buffer formulation.

ZIM3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 25200-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

ZIM 3, Zinc finger protein 657, ZNF657

---

Product Information

25200-1-PBS targets ZIM3 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18411

  Product name: Recombinant human ZIM3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 56-327 aa of BC114503

  Sequence: DVILRLEQGKEPWLEEEEVLGSGRAEKNGDIGGQIWKPKDVKESLAREVPSINKETLTTQKGVECDGSKKILPLGIDDVSSLQHYVQNNSHDDNGYRKLVGNNPSKFVGQQLKCNACRKLFSSKSRLQSHLRRHACQKPFECHSCGRAFGEKWKLDKHQKTHAEERPYKCENCGNAYKQKSNLFQHQKMHTKEKPYQCKTCGKAFSWKSSCINHEKIHNAKKSYQCNECEKSFRQNSTLIQHKKVHTGQKPFQCTDCGKAFIYKSDLVKHQR

• Full Name: zinc finger, imprinted 3
• Calculated Molecular Weight: 472 aa, 57 kDa
• Observed Molecular Weight: 55-65 kDa
• GenBank Accession Number: BC114503
• Gene Symbol: ZIM3
• Gene ID (NCBI): 114026
• RRID: AB_2879955
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96PE6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ZIM3 (Zinc Finger Imprinted 3), also known as ZNF657 or ZNF264, is a protein containing zinc finger and KRAB domains. It belongs to the Krüppel C2H2-type zinc finger protein family and comprises 11 C2H2-type zinc fingers and 1 KRAB domain. ZIM3 influences chromatin organization by binding to the KAP1 protein, thereby regulating gene transcription. ZIM3 is predicted to have DNA-binding transcription factor activity and is involved in the transcriptional regulation of RNA polymerase II. Additionally, ZIM3 plays a core regulatory role in human major zygotic genome activation (ZGA).