Tested Applications
Positive WB detected in | PC-3 cells, U2OS cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
26799-1-AP targets SLC39A1/ZIP1 in WB, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24937 Product name: Recombinant human SLC39A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 90-179 aa of BC003152 Sequence: PDYLAAIDEALAALHVTLQFPLQEFILAMGFFLVLVMEQITLAYKEQSGPSPLEETRALLGTVNGGPQHWHDGPGVPQASGAPATPSALR Predict reactive species |
Full Name | solute carrier family 39 (zinc transporter), member 1 |
Calculated Molecular Weight | 324 aa, 34 kDa |
Observed Molecular Weight | 34 kDa |
GenBank Accession Number | BC003152 |
Gene Symbol | SLC39A1 |
Gene ID (NCBI) | 27173 |
RRID | AB_3669568 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9NY26 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SLC39A1, also known as ZIP1, is a member of the zinc-iron permease family. It is localized to the cell membrane and acts as a zinc uptake transporter. SLC39A1 mediates the influx of Zn2+ into cells from extracellular space(PMID: 16844077).SLC39A1 is the major importer of zinc from circulating blood plasma into prostate cells (PMID: 12888280). In mesenchymal stem cells (MSCs), ZIP1 may exist as a dimer with a molecular weight of 70kD(PMID:16203195).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SLC39A1/ZIP1 antibody 26799-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |