ZIP13 Polyclonal antibody

• 

  WB analysis using 26496-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26496-1-AP (ZIP13 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 26496-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26496-1-AP (ZIP13 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

ZIP13 Polyclonal Antibody for WB, ELISA

Cat No. 26496-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

LZT Hs9, SLC39A13, Zinc transporter ZIP13, ZIP 13, ZIP13, Zrt and Irt like protein 13

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse skeletal muscle tissue, rat skeletal muscle tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26496-1-AP targets ZIP13 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24388

  Product name: Recombinant human SLC39A13 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-68 aa of BC008853

  Sequence: MPGCPCPGCGMAGPRLLFLTALALELLGRAGGSQPALRSRGTATACRLDNKESESWGALLSGERLDTW

• Full Name: solute carrier family 39 (zinc transporter), member 13
• Calculated Molecular Weight: 371 aa, 39 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC008853
• Gene Symbol: ZIP13
• Gene ID (NCBI): 91252
• RRID: AB_3085877
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96H72
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ZIP13, a member of the SLC39A/ZIP family, is mainly localized in the Golgi apparatus. It has been shown to play important roles in the development of bone, tooth and connective tissues. The apparent molecular weight of ZIP13 detected by SDS/PAGE was lower than its expected molecular mass (32 kDa), likely because of the largely hydrophobic nature of the protein, its high capacity to bind SDS, and, therefore, its more rapid migration during gel electrophoresis (PMID: 23213233).