Product Information
85383-1-PBS targets ZIP7 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human | 
| Host / Isotype | Rabbit / IgG | 
| Class | Recombinant | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag13798 Product name: Recombinant human SLC39A7 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 237-384 aa of BC000645 Sequence: VRHVKGGHGHSHGHGHAHSHTRGSHGHGRQERSTKEKQSSEEEEKETRGVQKRRGGSTVPKDGPVRPQNAEEEKRGLDLRVSGYLNLAADLAHNFTDGLAIGASFRGGRGLGILTTMTVLLHEVPHEVGDFAILVQSGCSKKQAMRLQ Predict reactive species | 
                                    
| Full Name | solute carrier family 39 (zinc transporter), member 7 | 
| Calculated Molecular Weight | 469 aa, 50 kDa | 
| Observed Molecular Weight | 45-50 kDa, 56 kDa | 
| GenBank Accession Number | BC000645 | 
| Gene Symbol | ZIP7 | 
| Gene ID (NCBI) | 7922 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Protein A purification | 
| UNIPROT ID | Q92504 | 
| Storage Buffer | PBS only, pH 7.3. | 
| Storage Conditions | Store at -80°C. | 
Background Information
ZIP7, also known as SLC39A7, is a member of the SLC39 family of zinc transporters. It is a transmembrane protein primarily localized to the endoplasmic reticulum (ER) and is involved in the transport of zinc ions from the ER and Golgi apparatus to the cytoplasm. This process is crucial for maintaining zinc homeostasis within the cell and regulating various signaling pathways.





