ZNF157 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ZNF157 Polyclonal antibody (33838-1-AP)

• 

  WB analysis using 33838-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33838-1-AP (ZNF157 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of U2OS using 33838-1-AP

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using ZNF157 antibody (33838-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

ZNF157 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 33838-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

Zinc finger protein 157, Zinc finger protein HZF22

---

Tested Applications

• Positive WB detected in: HEK-293 cells, PC-3 cells, SH-SY5Y cells, SK-N-SH cells
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33838-1-AP targets ZNF157 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag39863

  Product name: Recombinant human ZNF157 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-180 aa of BC075003

  Sequence: MPANGTSPQRFPALIPGEPGRSFEGSVSFEDVAVDFTRQEWHRLDPAQRTMHKDVMLETYSNLASVGLCVAKPEMIFKLERGEELWILEEESSGHGYSGSLSLLCGNGSVGDNALRHDNDLLHHQKIQTLDQNVEYNGCRKAFHEKTGFVRRKRTPRGDKNFECHECGKAYCRKSNLVEH

• Full Name: zinc finger protein 157
• Observed Molecular Weight: 55-65 kDa
• GenBank Accession Number: BC075003
• Gene Symbol: ZNF157
• Gene ID (NCBI): 7712
• RRID: AB_3743087
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P51786
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ZNF157, also known as HZF22, is a zinc finger protein gene located at the X chromosome short arm region 11.3. As a member of the zinc finger protein family, ZNF157 primarily functions through its C2H2-type zinc finger domain. This domain enables ZNF157 to bind to DNA, thereby playing a key role in the regulation of gene expression.