ZNF185 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ZNF185 Polyclonal antibody (31477-1-AP)

• 

  WB analysis of HeLa using 31477-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 31477-1-AP (ZNF185 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 31477-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using ZNF185 antibody (31477-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

ZNF185 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 31477-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

LIM domain protein ZNF185, P1-A, Zinc finger protein 185

---

Tested Applications

• Positive WB detected in: HeLa cells, MCF-7 cells, U2OS cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

31477-1-AP targets ZNF185 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35743

  Product name: Recombinant human ZNF185 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 193-400 aa of NM_007150.3

  Sequence: HSYVLSAAKKSTGPTQETQAPFIAKRVEVVEEDGPSEKSQDPPALARSTPGSNSADGGRTKASRAIWIECLPSMPSPAGSQELSSRGEEIVRLQILTPRAGLRLVAPDVEGMRSSPGNKDKEAPCSRELQRDLAGEEAFRAPNTDAARSSAQLSDGNVGSGATGSRPEGLAAVDIGSERGSSSATSVSAVPADRKSNSTAAQEDAKAD

• Full Name: zinc finger protein 185 (LIM domain)
• Calculated Molecular Weight: 74kDa，689aa
• Observed Molecular Weight: 74 kDa
• GenBank Accession Number: NM_007150.3
• Gene Symbol: ZNF185
• Gene ID (NCBI): 7739
• RRID: AB_3665885
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O15231
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Res; A Genome-Wide Synthetic Lethal Screen Identifies Spermidine Synthase as a Target to Enhance Erdafitinib Efficacy in FGFR-Mutant Bladder Cancer; Authors - Yanchao Yu