ZNF195 Polyclonal antibody

• 

  WB analysis of fetal human brain using 24861-1-AP

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 24861-1-AP (ZNF195 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse skeletal muscle using 24861-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 24861-1-AP (ZNF195 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human heart using 24861-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 24861-1-AP (ZNF195 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

ZNF195 Polyclonal Antibody for WB, ELISA

Cat No. 24861-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

zinc finger protein 195, ZNF195, ZNFP104

---

Tested Applications

• Positive WB detected in: fetal human brain tissue, human heart tissue, mouse skeletal muscle tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24861-1-AP targets ZNF195 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21735

  Product name: Recombinant human ZNF195 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 69-174 aa of BC121029

  Sequence: EAADGHPEMGFHHATQACLELLGSSDLPASASQSAGITGVNHRAQPGLNVSVDKFTAMSSHFTQDLLPEQGIQDAFPKRILRGYGNCGLDNLYLRKDWESLDECKL

• Full Name: zinc finger protein 195
• Calculated Molecular Weight: 629 aa, 72 kDa
• Observed Molecular Weight: 64 kDa
• GenBank Accession Number: BC121029
• Gene Symbol: ZNF195
• Gene ID (NCBI): 7748
• RRID: AB_2879760
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14628
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.