Tested Applications
| Positive WB detected in | HeLa cells, Jurkat cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25458-1-AP targets ZNF211 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22135 Product name: Recombinant human ZNF211 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 199-268 aa of BC110856 Sequence: CREIRKDFLANMRFLHQDATQTGEKPNNSNKCAVAFYSGKSHHNWGKCSKAFSHIDTLVQDQRILTREGL Predict reactive species |
| Full Name | zinc finger protein 211 |
| Calculated Molecular Weight | 576 aa, 66 kDa |
| Observed Molecular Weight | 60 kDa |
| GenBank Accession Number | BC110856 |
| Gene Symbol | ZNF211 |
| Gene ID (NCBI) | 10520 |
| RRID | AB_2880090 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13398 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for ZNF211 antibody 25458-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Reviews
What customers say
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Daniel (Verified Customer) (10-26-2022) | This antibody works at low dilutions and using PVDF only.
![]() |




