ZNF211 Polyclonal antibody

• 

  WB analysis of HeLa using 25458-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 25458-1-AP (ZNF211 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 25458-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 25458-1-AP (ZNF211 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

ZNF211 Polyclonal Antibody for WB, ELISA

Cat No. 25458-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

C2H2 25, CH2H2 25, zinc finger protein 211, Zinc finger protein C2H2 25, ZNF 25, ZNF211, ZNFC25

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25458-1-AP targets ZNF211 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22135

  Product name: Recombinant human ZNF211 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 199-268 aa of BC110856

  Sequence: CREIRKDFLANMRFLHQDATQTGEKPNNSNKCAVAFYSGKSHHNWGKCSKAFSHIDTLVQDQRILTREGL

• Full Name: zinc finger protein 211
• Calculated Molecular Weight: 576 aa, 66 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC110856
• Gene Symbol: ZNF211
• Gene ID (NCBI): 10520
• RRID: AB_2880090
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13398
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Daniel (Verified Customer) (10-26-2022)

This antibody works at low dilutions and using PVDF only.

• Applications: Western Blot
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: HEK293T, MT4 cells

ZNF211 Antibody Western Blot validation (1:500 dilution) in HEK293T, MT4 cells (Cat no:25458-1-AP)