ZNF211 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ZNF211 Polyclonal antibody (25458-1-AP)

ZNF211 Polyclonal Antibody for WB, ELISA

Cat No. 25458-1-AP Copied!

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

C2H2 25, CH2H2 25, zinc finger protein 211, Zinc finger protein C2H2 25, ZNF 25, ZNF211, ZNFC25

• 

  WB analysis of HeLa using 25458-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 25458-1-AP (ZNF211 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 25458-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 25458-1-AP (ZNF211 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ZNF211 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25458-1-AP targets ZNF211 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22135

  Product name: Recombinant human ZNF211 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 199-268 aa of BC110856

  Sequence: CREIRKDFLANMRFLHQDATQTGEKPNNSNKCAVAFYSGKSHHNWGKCSKAFSHIDTLVQDQRILTREGL

• Full Name: zinc finger protein 211
• Calculated Molecular Weight: 576 aa, 66 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC110856
• Gene Symbol: ZNF211
• Gene ID (NCBI): 10520
• RRID: AB_2880090
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13398
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Reviews

4.0 out of 5

1 verified customer reviews

What customers say

The single review for this antibody rates it 4 out of 5 stars for Western Blot. The reviewer used a 1:500 dilution on HEK293T and MT4 cells and noted that the antibody performs well at low dilutions but works best with PVDF membranes specifically. Overall, the feedback is positive, highlighting reliable performance under standard WB conditions.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Daniel (Verified Customer) (10-26-2022)

This antibody works at low dilutions and using PVDF only.

• Applications: Western Blot
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: HEK293T, MT4 cells

ZNF211 Antibody Western Blot validation (1:500 dilution) in HEK293T, MT4 cells (Cat no:25458-1-AP)