Tested Applications
Positive WB detected in | HeLa cells, Jurkat cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
25458-1-AP targets ZNF211 in WB, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag22135 Product name: Recombinant human ZNF211 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 199-268 aa of BC110856 Sequence: CREIRKDFLANMRFLHQDATQTGEKPNNSNKCAVAFYSGKSHHNWGKCSKAFSHIDTLVQDQRILTREGL Predict reactive species |
Full Name | zinc finger protein 211 |
Calculated Molecular Weight | 576 aa, 66 kDa |
Observed Molecular Weight | 60 kDa |
GenBank Accession Number | BC110856 |
Gene Symbol | ZNF211 |
Gene ID (NCBI) | 10520 |
RRID | AB_2880090 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q13398 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ZNF211 antibody 25458-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Daniel (Verified Customer) (10-26-2022) | This antibody works at low dilutions and using PVDF only.
![]() |