ZNF235 Polyclonal antibody

• 

ZNF235 Polyclonal Antibody for ELISA

Cat No. 19818-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

IF, IHC, ELISA

Synonyms

ANF270, HZF6, Zfp 93, ZFP93, zinc finger protein 235, Zinc finger protein 270, Zinc finger protein 93 homolog, Zinc finger protein HZF6, ZNF235, ZNF270

---

Published Applications

• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

19818-1-AP targets ZNF235 in IF, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13866

  Product name: Recombinant human ZNF235 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-81 aa of BC002663

  Sequence: MTKFQEAVTFKDVAVAFTEEELGLLDSAQRKLYRDVMLENFRNLVSVGHQSFKPDMISQLEREEKLWMKELQTQRGKHSET

• Full Name: zinc finger protein 235
• Calculated Molecular Weight: 738 aa, 84 kDa
• GenBank Accession Number: BC002663
• Gene Symbol: ZNF235
• Gene ID (NCBI): 9310
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14590
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	IF,IHC	J Cardiovasc Transl Res; Exosomes Derived from AT2R-Overexpressing BMSC Prevent Restenosis After Carotid Artery Injury by Attenuating the Injury-Induced Neointimal Hyperplasia.; Authors - Xinliang Zou