Product Information
19818-1-AP targets ZNF235 in IF, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13866 Product name: Recombinant human ZNF235 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-81 aa of BC002663 Sequence: MTKFQEAVTFKDVAVAFTEEELGLLDSAQRKLYRDVMLENFRNLVSVGHQSFKPDMISQLEREEKLWMKELQTQRGKHSET Predict reactive species |
| Full Name | zinc finger protein 235 |
| Calculated Molecular Weight | 738 aa, 84 kDa |
| GenBank Accession Number | BC002663 |
| Gene Symbol | ZNF235 |
| Gene ID (NCBI) | 9310 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q14590 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Publications
What published studies show
The ZNF235 Polyclonal antibody (Cat# 19818-1-AP) has 1 citation. It was used in a study published in Journal of Cardiovascular Translational Research (IF: 2.6, 2022), which investigated how exosomes derived from AT2R-overexpressing bone marrow stromal cells prevent restenosis after carotid artery injury by attenuating neointimal hyperplasia. The antibody was applied in IF and IHC on rat samples. The research field is cardiovascular biology, focusing on vascular injury repair and exosome-mediated mechanisms.
| Species | Application | Title |
|---|---|---|
J Cardiovasc Transl Res Exosomes Derived from AT2R-Overexpressing BMSC Prevent Restenosis After Carotid Artery Injury by Attenuating the Injury-Induced Neointimal Hyperplasia. |
