Tested Applications
Positive WB detected in | mouse testis tissue, HepG2 cells, mouse skeletal muscle tissue, SKOV-3 cells |
Positive IF/ICC detected in | SKOV-3 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 2 publications below |
Product Information
25601-1-AP targets ZNF251 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag22347 Product name: Recombinant human ZNF251 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 82-179 aa of BC112137 Sequence: DCGDCGKAFSRRSTLIQHQKVHSGETRKCRKHGPAFVHGSSLTADGQIPTGEKHGRAFNHGANLILRWTVHTGEKSFGCNEYGKAFSPTSRPTEDQIM Predict reactive species |
Full Name | zinc finger protein 251 |
Calculated Molecular Weight | 671 aa, 76 kDa |
Observed Molecular Weight | 70-76 kDa |
GenBank Accession Number | BC112137 |
Gene Symbol | ZNF251 |
Gene ID (NCBI) | 90987 |
RRID | AB_2880154 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9BRH9 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ZNF251 antibody 25601-1-AP | Download protocol |
IF protocol for ZNF251 antibody 25601-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Res Sq Haploinsufficiency of ZNF251 causes DNA-PKcs-dependent resistance to PARP inhibitors in BRCA1-mutated cancer cells
| ||
Cancer Lett ZNF251 haploinsufficiency confers PARP inhibitors resistance in BRCA1-mutated cancer cells through activation of homologous recombination
|