ZNF251 Polyclonal antibody

• 

  WB analysis of mouse testis using 25601-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 25601-1-AP (ZNF251 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse skeletal muscle using 25601-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 25601-1-AP (ZNF251 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 25601-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 25601-1-AP (ZNF251 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SKOV-3 using 25601-1-AP

  SKOV-3 cells were subjected to SDS PAGE followed by western blot with 25601-1-AP (ZNF251 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IF Staining of SKOV-3 using 25601-1-AP

  Immunofluorescent analysis of SKOV-3 cells using 25601-1-AP (ZNF251 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

ZNF251 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 25601-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, ELISA

Synonyms

zinc finger protein 251, ZNF251

---

Tested Applications

• Positive WB detected in: mouse testis tissue, HepG2 cells, mouse skeletal muscle tissue, SKOV-3 cells
• Positive IF/ICC detected in: SKOV-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 2 publications below

Product Information

25601-1-AP targets ZNF251 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22347

  Product name: Recombinant human ZNF251 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 82-179 aa of BC112137

  Sequence: DCGDCGKAFSRRSTLIQHQKVHSGETRKCRKHGPAFVHGSSLTADGQIPTGEKHGRAFNHGANLILRWTVHTGEKSFGCNEYGKAFSPTSRPTEDQIM

• Full Name: zinc finger protein 251
• Calculated Molecular Weight: 671 aa, 76 kDa
• Observed Molecular Weight: 70-76 kDa
• GenBank Accession Number: BC112137
• Gene Symbol: ZNF251
• Gene ID (NCBI): 90987
• RRID: AB_2880154
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BRH9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Res Sq; Haploinsufficiency of ZNF251 causes DNA-PKcs-dependent resistance to PARP inhibitors in BRCA1-mutated cancer cells; Authors - Huan Li ; KD Validated
human	WB	Cancer Lett; ZNF251 haploinsufficiency confers PARP inhibitors resistance in BRCA1-mutated cancer cells through activation of homologous recombination; Authors - Huan Li ; KD Validated