ZNF251 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ZNF251 Polyclonal antibody (25601-1-AP)

• Featured Product
• KD/KO Validated

ZNF251 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 25601-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

Zinc finger protein 251

• 

  WB analysis using 25601-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25601-1-AP (ZNF251 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 25601-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 25601-1-AP (ZNF251 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse skeletal muscle using 25601-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 25601-1-AP (ZNF251 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 25601-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 25601-1-AP (ZNF251 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of SKOV-3 using 25601-1-AP

  SKOV-3 cells were subjected to SDS PAGE followed by western blot with 25601-1-AP (ZNF251 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of SKOV-3 using 25601-1-AP

  Immunofluorescent analysis of SKOV-3 cells using 25601-1-AP (ZNF251 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ZNF251 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, HepG2 cells, SKOV-3 cells, mouse testis tissue, mouse skeletal muscle tissue, rat testis tissue
• Positive IF/ICC detected in: SKOV-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25601-1-AP targets ZNF251 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22347

  Product name: Recombinant human ZNF251 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 82-179 aa of BC112137

  Sequence: DCGDCGKAFSRRSTLIQHQKVHSGETRKCRKHGPAFVHGSSLTADGQIPTGEKHGRAFNHGANLILRWTVHTGEKSFGCNEYGKAFSPTSRPTEDQIM

• Full Name: zinc finger protein 251
• Calculated Molecular Weight: 671 aa, 76 kDa
• Observed Molecular Weight: 70-76 kDa
• GenBank Accession Number: BC112137
• Gene Symbol: ZNF251
• Gene ID (NCBI): 90987
• RRID: AB_2880154
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BRH9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The ZNF251 Polyclonal antibody (Cat# 25601-1-AP) has 2 citations. These appear in Cancer Letters (IF 11.8) and Research Square. Both studies, led by Huan Li, investigate ZNF251 haploinsufficiency and its role in conferring PARP inhibitor resistance in BRCA1-mutated cancer cells, with one focusing on homologous recombination activation and the other on DNA-PKcs-dependent mechanisms. The research fields encompass cancer biology, DNA repair, and therapeutic resistance. The antibody was applied in Western Blot (WB) on human samples in both publications.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Lett; ZNF251 haploinsufficiency confers PARP inhibitors resistance in BRCA1-mutated cancer cells through activation of homologous recombination; Authors - Huan Li ; KD Validated
human	WB	Res Sq; Haploinsufficiency of ZNF251 causes DNA-PKcs-dependent resistance to PARP inhibitors in BRCA1-mutated cancer cells; Authors - Huan Li ; KD Validated